package sdk

import "github.com/aws/aws-sdk-go"

Package sdk is the official AWS SDK for the Go programming language.

The AWS SDK for Go provides APIs and utilities that developers can use to build Go applications that use AWS services, such as Amazon Elastic Compute Cloud (Amazon EC2) and Amazon Simple Storage Service (Amazon S3).

The SDK removes the complexity of coding directly against a web service interface. It hides a lot of the lower-level plumbing, such as authentication, request retries, and error handling.

The SDK also includes helpful utilities on top of the AWS APIs that add additional capabilities and functionality. For example, the Amazon S3 Download and Upload Manager will automatically split up large objects into multiple parts and transfer them concurrently.

See the s3manager package documentation for more information. https://docs.aws.amazon.com/sdk-for-go/api/service/s3/s3manager/

Getting More Information ¶

Checkout the Getting Started Guide and API Reference Docs detailed the SDK's components and details on each AWS client the SDK supports.

The Getting Started Guide provides examples and detailed description of how to get setup with the SDK. https://docs.aws.amazon.com/sdk-for-go/v1/developer-guide/welcome.html

The API Reference Docs include a detailed breakdown of the SDK's components such as utilities and AWS clients. Use this as a reference of the Go types included with the SDK, such as AWS clients, API operations, and API parameters. https://docs.aws.amazon.com/sdk-for-go/api/

Overview of SDK's Packages ¶

The SDK is composed of two main components, SDK core, and service clients. The SDK core packages are all available under the aws package at the root of the SDK. Each client for a supported AWS service is available within its own package under the service folder at the root of the SDK.

* aws - SDK core, provides common shared types such as Config, Logger,
  and utilities to make working with API parameters easier.

    * awserr - Provides the error interface that the SDK will use for all
      errors that occur in the SDK's processing. This includes service API
      response errors as well. The Error type is made up of a code and message.
      Cast the SDK's returned error type to awserr.Error and call the Code
      method to compare returned error to specific error codes. See the package's
      documentation for additional values that can be extracted such as RequestId.

    * credentials - Provides the types and built in credentials providers
      the SDK will use to retrieve AWS credentials to make API requests with.
      Nested under this folder are also additional credentials providers such as
      stscreds for assuming IAM roles, and ec2rolecreds for EC2 Instance roles.

    * endpoints - Provides the AWS Regions and Endpoints metadata for the SDK.
      Use this to lookup AWS service endpoint information such as which services
      are in a region, and what regions a service is in. Constants are also provided
      for all region identifiers, e.g UsWest2RegionID for "us-west-2".

    * session - Provides initial default configuration, and load
      configuration from external sources such as environment and shared
      credentials file.

    * request - Provides the API request sending, and retry logic for the SDK.
      This package also includes utilities for defining your own request
      retryer, and configuring how the SDK processes the request.

* service - Clients for AWS services. All services supported by the SDK are
  available under this folder.

How to Use the SDK's AWS Service Clients ¶

The SDK includes the Go types and utilities you can use to make requests to AWS service APIs. Within the service folder at the root of the SDK you'll find a package for each AWS service the SDK supports. All service clients follows a common pattern of creation and usage.

When creating a client for an AWS service you'll first need to have a Session value constructed. The Session provides shared configuration that can be shared between your service clients. When service clients are created you can pass in additional configuration via the aws.Config type to override configuration provided by in the Session to create service client instances with custom configuration.

Once the service's client is created you can use it to make API requests the AWS service. These clients are safe to use concurrently.

Configuring the SDK ¶

In the AWS SDK for Go, you can configure settings for service clients, such as the log level and maximum number of retries. Most settings are optional; however, for each service client, you must specify a region and your credentials. The SDK uses these values to send requests to the correct AWS region and sign requests with the correct credentials. You can specify these values as part of a session or as environment variables.

See the SDK's configuration guide for more information. https://docs.aws.amazon.com/sdk-for-go/v1/developer-guide/configuring-sdk.html

See the session package documentation for more information on how to use Session with the SDK. https://docs.aws.amazon.com/sdk-for-go/api/aws/session/

See the Config type in the aws package for more information on configuration options. https://docs.aws.amazon.com/sdk-for-go/api/aws/#Config

Configuring Credentials ¶

When using the SDK you'll generally need your AWS credentials to authenticate with AWS services. The SDK supports multiple methods of supporting these credentials. By default the SDK will source credentials automatically from its default credential chain. See the session package for more information on this chain, and how to configure it. The common items in the credential chain are the following:

* Environment Credentials - Set of environment variables that are useful
  when sub processes are created for specific roles.

* Shared Credentials file (~/.aws/credentials) - This file stores your
  credentials based on a profile name and is useful for local development.

* EC2 Instance Role Credentials - Use EC2 Instance Role to assign credentials
  to application running on an EC2 instance. This removes the need to manage
  credential files in production.

Credentials can be configured in code as well by setting the Config's Credentials value to a custom provider or using one of the providers included with the SDK to bypass the default credential chain and use a custom one. This is helpful when you want to instruct the SDK to only use a specific set of credentials or providers.

This example creates a credential provider for assuming an IAM role, "myRoleARN" and configures the S3 service client to use that role for API requests.

// Initial credentials loaded from SDK's default credential chain. Such as
// the environment, shared credentials (~/.aws/credentials), or EC2 Instance
// Role. These credentials will be used to to make the STS Assume Role API.
sess := session.Must(session.NewSession())

// Create the credentials from AssumeRoleProvider to assume the role
// referenced by the "myRoleARN" ARN.
creds := stscreds.NewCredentials(sess, "myRoleArn")

// Create service client value configured for credentials
// from assumed role.
svc := s3.New(sess, &aws.Config{Credentials: creds})/

See the credentials package documentation for more information on credential providers included with the SDK, and how to customize the SDK's usage of credentials. https://docs.aws.amazon.com/sdk-for-go/api/aws/credentials

The SDK has support for the shared configuration file (~/.aws/config). This support can be enabled by setting the environment variable, "AWS_SDK_LOAD_CONFIG=1", or enabling the feature in code when creating a Session via the Option's SharedConfigState parameter.

sess := session.Must(session.NewSessionWithOptions(session.Options{
    SharedConfigState: session.SharedConfigEnable,
}))

Configuring AWS Region ¶

In addition to the credentials you'll need to specify the region the SDK will use to make AWS API requests to. In the SDK you can specify the region either with an environment variable, or directly in code when a Session or service client is created. The last value specified in code wins if the region is specified multiple ways.

To set the region via the environment variable set the "AWS_REGION" to the region you want to the SDK to use. Using this method to set the region will allow you to run your application in multiple regions without needing additional code in the application to select the region.

AWS_REGION=us-west-2

The endpoints package includes constants for all regions the SDK knows. The values are all suffixed with RegionID. These values are helpful, because they reduce the need to type the region string manually.

To set the region on a Session use the aws package's Config struct parameter Region to the AWS region you want the service clients created from the session to use. This is helpful when you want to create multiple service clients, and all of the clients make API requests to the same region.

sess := session.Must(session.NewSession(&aws.Config{
    Region: aws.String(endpoints.UsWest2RegionID),
}))

See the endpoints package for the AWS Regions and Endpoints metadata. https://docs.aws.amazon.com/sdk-for-go/api/aws/endpoints/

In addition to setting the region when creating a Session you can also set the region on a per service client bases. This overrides the region of a Session. This is helpful when you want to create service clients in specific regions different from the Session's region.

svc := s3.New(sess, &aws.Config{
    Region: aws.String(endpoints.UsWest2RegionID),
})

See the Config type in the aws package for more information and additional options such as setting the Endpoint, and other service client configuration options. https://docs.aws.amazon.com/sdk-for-go/api/aws/#Config

Making API Requests ¶

Once the client is created you can make an API request to the service. Each API method takes a input parameter, and returns the service response and an error. The SDK provides methods for making the API call in multiple ways.

In this list we'll use the S3 ListObjects API as an example for the different ways of making API requests.

* ListObjects - Base API operation that will make the API request to the service.

* ListObjectsRequest - API methods suffixed with Request will construct the
  API request, but not send it. This is also helpful when you want to get a
  presigned URL for a request, and share the presigned URL instead of your
  application making the request directly.

* ListObjectsPages - Same as the base API operation, but uses a callback to
  automatically handle pagination of the API's response.

* ListObjectsWithContext - Same as base API operation, but adds support for
  the Context pattern. This is helpful for controlling the canceling of in
  flight requests. See the Go standard library context package for more
  information. This method also takes request package's Option functional
  options as the variadic argument for modifying how the request will be
  made, or extracting information from the raw HTTP response.

* ListObjectsPagesWithContext - same as ListObjectsPages, but adds support for
  the Context pattern. Similar to ListObjectsWithContext this method also
  takes the request package's Option function option types as the variadic
  argument.

In addition to the API operations the SDK also includes several higher level methods that abstract checking for and waiting for an AWS resource to be in a desired state. In this list we'll use WaitUntilBucketExists to demonstrate the different forms of waiters.

* WaitUntilBucketExists. - Method to make API request to query an AWS service for
  a resource's state. Will return successfully when that state is accomplished.

* WaitUntilBucketExistsWithContext - Same as WaitUntilBucketExists, but adds
  support for the Context pattern. In addition these methods take request
  package's WaiterOptions to configure the waiter, and how underlying request
  will be made by the SDK.

The API method will document which error codes the service might return for the operation. These errors will also be available as const strings prefixed with "ErrCode" in the service client's package. If there are no errors listed in the API's SDK documentation you'll need to consult the AWS service's API documentation for the errors that could be returned.

ctx := context.Background()

result, err := svc.GetObjectWithContext(ctx, &s3.GetObjectInput{
    Bucket: aws.String("my-bucket"),
    Key: aws.String("my-key"),
})
if err != nil {
    // Cast err to awserr.Error to handle specific error codes.
    aerr, ok := err.(awserr.Error)
    if ok && aerr.Code() == s3.ErrCodeNoSuchKey {
        // Specific error code handling
    }
    return err
}

// Make sure to close the body when done with it for S3 GetObject APIs or
// will leak connections.
defer result.Body.Close()

fmt.Println("Object Size:", aws.StringValue(result.ContentLength))

API Request Pagination and Resource Waiters ¶

Pagination helper methods are suffixed with "Pages", and provide the functionality needed to round trip API page requests. Pagination methods take a callback function that will be called for each page of the API's response.

objects := []string{}
err := svc.ListObjectsPagesWithContext(ctx, &s3.ListObjectsInput{
    Bucket: aws.String(myBucket),
}, func(p *s3.ListObjectsOutput, lastPage bool) bool {
    for _, o := range p.Contents {
        objects = append(objects, aws.StringValue(o.Key))
    }
    return true // continue paging
})
if err != nil {
    panic(fmt.Sprintf("failed to list objects for bucket, %s, %v", myBucket, err))
}

fmt.Println("Objects in bucket:", objects)

Waiter helper methods provide the functionality to wait for an AWS resource state. These methods abstract the logic needed to to check the state of an AWS resource, and wait until that resource is in a desired state. The waiter will block until the resource is in the state that is desired, an error occurs, or the waiter times out. If a resource times out the error code returned will be request.WaiterResourceNotReadyErrorCode.

err := svc.WaitUntilBucketExistsWithContext(ctx, &s3.HeadBucketInput{
    Bucket: aws.String(myBucket),
})
if err != nil {
    aerr, ok := err.(awserr.Error)
    if ok && aerr.Code() == request.WaiterResourceNotReadyErrorCode {
        fmt.Fprintf(os.Stderr, "timed out while waiting for bucket to exist")
    }
    panic(fmt.Errorf("failed to wait for bucket to exist, %v", err))
}
fmt.Println("Bucket", myBucket, "exists")

Complete SDK Example ¶

This example shows a complete working Go file which will upload a file to S3 and use the Context pattern to implement timeout logic that will cancel the request if it takes too long. This example highlights how to use sessions, create a service client, make a request, handle the error, and process the response.

 package main

 import (
 	"context"
 	"flag"
 	"fmt"
 	"os"
 	"time"

 	"github.com/aws/aws-sdk-go/aws"
 	"github.com/aws/aws-sdk-go/aws/awserr"
 	"github.com/aws/aws-sdk-go/aws/request"
 	"github.com/aws/aws-sdk-go/aws/session"
 	"github.com/aws/aws-sdk-go/service/s3"
 )

 // Uploads a file to S3 given a bucket and object key. Also takes a duration
 // value to terminate the update if it doesn't complete within that time.
 //
 // The AWS Region needs to be provided in the AWS shared config or on the
 // environment variable as `AWS_REGION`. Credentials also must be provided
 // Will default to shared config file, but can load from environment if provided.
 //
 // Usage:
 //   # Upload myfile.txt to myBucket/myKey. Must complete within 10 minutes or will fail
 //   go run withContext.go -b mybucket -k myKey -d 10m < myfile.txt
 func main() {
 	var bucket, key string
 	var timeout time.Duration

 	flag.StringVar(&bucket, "b", "", "Bucket name.")
 	flag.StringVar(&key, "k", "", "Object key name.")
 	flag.DurationVar(&timeout, "d", 0, "Upload timeout.")
 	flag.Parse()

 	// All clients require a Session. The Session provides the client with
	// shared configuration such as region, endpoint, and credentials. A
	// Session should be shared where possible to take advantage of
	// configuration and credential caching. See the session package for
	// more information.
 	sess := session.Must(session.NewSession())

	// Create a new instance of the service's client with a Session.
	// Optional aws.Config values can also be provided as variadic arguments
	// to the New function. This option allows you to provide service
	// specific configuration.
 	svc := s3.New(sess)

 	// Create a context with a timeout that will abort the upload if it takes
 	// more than the passed in timeout.
 	ctx := context.Background()
 	var cancelFn func()
 	if timeout > 0 {
 		ctx, cancelFn = context.WithTimeout(ctx, timeout)
 	}
 	// Ensure the context is canceled to prevent leaking.
 	// See context package for more information, https://golang.org/pkg/context/
 	defer cancelFn()

 	// Uploads the object to S3. The Context will interrupt the request if the
 	// timeout expires.
 	_, err := svc.PutObjectWithContext(ctx, &s3.PutObjectInput{
 		Bucket: aws.String(bucket),
 		Key:    aws.String(key),
 		Body:   os.Stdin,
 	})
 	if err != nil {
 		if aerr, ok := err.(awserr.Error); ok && aerr.Code() == request.CanceledErrorCode {
 			// If the SDK can determine the request or retry delay was canceled
 			// by a context the CanceledErrorCode error code will be returned.
 			fmt.Fprintf(os.Stderr, "upload canceled due to timeout, %v\n", err)
 		} else {
 			fmt.Fprintf(os.Stderr, "failed to upload object, %v\n", err)
 		}
 		os.Exit(1)
 	}

 	fmt.Printf("successfully uploaded file to %s/%s\n", bucket, key)
 }

Index ¶

Package Files ¶

doc.go

Directories ¶

Path	Synopsis
aws	Package aws provides the core SDK's utilities and shared types.
aws/arn	Package arn provides a parser for interacting with Amazon Resource Names.
aws/awserr	Package awserr represents API error interface accessors for the SDK.
aws/awsutil
aws/client
aws/client/metadata
aws/corehandlers
aws/credentials	Package credentials provides credential retrieval and management
aws/credentials/ec2rolecreds
aws/credentials/endpointcreds	Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.
aws/credentials/plugincreds	Package plugincreds implements a credentials provider sourced from a Go plugin.
aws/credentials/processcreds	Package processcreds is a credential Provider to retrieve `credential_process` credentials.
aws/credentials/stscreds	Package stscreds are credential Providers to retrieve STS AWS credentials.
aws/crr
aws/csm	Package csm provides the Client Side Monitoring (CSM) client which enables sending metrics via UDP connection to the CSM agent.
aws/defaults	Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.
aws/ec2metadata	Package ec2metadata provides the client for making API calls to the EC2 Metadata service.
aws/endpoints	Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.
aws/request
aws/session	Package session provides configuration for the SDK's service clients.
aws/signer/v4	Package v4 implements signing for AWS V4 signer
awstesting
awstesting/mock
awstesting/unit	Package unit performs initialization and validation for unit tests
internal/ini	Package ini is an LL(1) parser for configuration files.
internal/s3err
internal/sdkio
internal/sdkrand
internal/sdktesting
internal/sdkuri
internal/shareddefaults
private/model/api
private/protocol
private/protocol/ec2query	Package ec2query provides serialization of AWS EC2 requests and responses.
private/protocol/eventstream
private/protocol/eventstream/eventstreamapi
private/protocol/eventstream/eventstreamtest
private/protocol/json/jsonutil	Package jsonutil provides JSON serialization of AWS requests and responses.
private/protocol/jsonrpc	Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses.
private/protocol/query	Package query provides serialization of AWS query requests, and responses.
private/protocol/query/queryutil
private/protocol/rest	Package rest provides RESTful serialization of AWS requests and responses.
private/protocol/restjson	Package restjson provides RESTful JSON serialization of AWS requests and responses.
private/protocol/restxml	Package restxml provides RESTful XML serialization of AWS requests and responses.
private/protocol/xml/xmlutil	Package xmlutil provides XML serialization of AWS requests and responses.
private/signer/v2
private/util
service	Package service contains automatically generated AWS clients.
service/acm	Package acm provides the client and types for making API requests to AWS Certificate Manager.
service/acm/acmiface	Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
service/acmpca	Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
service/acmpca/acmpcaiface	Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
service/alexaforbusiness	Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
service/alexaforbusiness/alexaforbusinessiface	Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
service/amplify	Package amplify provides the client and types for making API requests to AWS Amplify.
service/amplify/amplifyiface	Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
service/apigateway	Package apigateway provides the client and types for making API requests to Amazon API Gateway.
service/apigateway/apigatewayiface	Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
service/apigatewaymanagementapi	Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
service/apigatewaymanagementapi/apigatewaymanagementapiiface	Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
service/apigatewayv2	Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
service/apigatewayv2/apigatewayv2iface	Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
service/applicationautoscaling	Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
service/applicationautoscaling/applicationautoscalingiface	Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
service/applicationdiscoveryservice	Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
service/applicationdiscoveryservice/applicationdiscoveryserviceiface	Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
service/applicationinsights	Package applicationinsights provides the client and types for making API requests to Amazon CloudWatch Application Insights.
service/applicationinsights/applicationinsightsiface	Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
service/appmesh	Package appmesh provides the client and types for making API requests to AWS App Mesh.
service/appmesh/appmeshiface	Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
service/appstream	Package appstream provides the client and types for making API requests to Amazon AppStream.
service/appstream/appstreamiface	Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
service/appsync	Package appsync provides the client and types for making API requests to AWS AppSync.
service/appsync/appsynciface	Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
service/athena	Package athena provides the client and types for making API requests to Amazon Athena.
service/athena/athenaiface	Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
service/autoscaling	Package autoscaling provides the client and types for making API requests to Auto Scaling.
service/autoscaling/autoscalingiface	Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
service/autoscalingplans	Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
service/autoscalingplans/autoscalingplansiface	Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
service/backup	Package backup provides the client and types for making API requests to AWS Backup.
service/backup/backupiface	Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
service/batch	Package batch provides the client and types for making API requests to AWS Batch.
service/batch/batchiface	Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
service/budgets	Package budgets provides the client and types for making API requests to AWS Budgets.
service/budgets/budgetsiface	Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
service/chime	Package chime provides the client and types for making API requests to Amazon Chime.
service/chime/chimeiface	Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
service/cloud9	Package cloud9 provides the client and types for making API requests to AWS Cloud9.
service/cloud9/cloud9iface	Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
service/clouddirectory	Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
service/clouddirectory/clouddirectoryiface	Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
service/cloudformation	Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
service/cloudformation/cloudformationiface	Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
service/cloudfront	Package cloudfront provides the client and types for making API requests to Amazon CloudFront.
service/cloudfront/cloudfrontiface	Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
service/cloudfront/sign	Package sign provides utilities to generate signed URLs for Amazon CloudFront.
service/cloudhsm	Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
service/cloudhsm/cloudhsmiface	Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
service/cloudhsmv2	Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
service/cloudhsmv2/cloudhsmv2iface	Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
service/cloudsearch	Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
service/cloudsearch/cloudsearchiface	Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
service/cloudsearchdomain	Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
service/cloudsearchdomain/cloudsearchdomainiface	Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
service/cloudtrail	Package cloudtrail provides the client and types for making API requests to AWS CloudTrail.
service/cloudtrail/cloudtrailiface	Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
service/cloudwatch	Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
service/cloudwatch/cloudwatchiface	Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
service/cloudwatchevents	Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
service/cloudwatchevents/cloudwatcheventsiface	Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
service/cloudwatchlogs	Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
service/cloudwatchlogs/cloudwatchlogsiface	Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
service/codebuild	Package codebuild provides the client and types for making API requests to AWS CodeBuild.
service/codebuild/codebuildiface	Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
service/codecommit	Package codecommit provides the client and types for making API requests to AWS CodeCommit.
service/codecommit/codecommitiface	Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
service/codedeploy	Package codedeploy provides the client and types for making API requests to AWS CodeDeploy.
service/codedeploy/codedeployiface	Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
service/codepipeline	Package codepipeline provides the client and types for making API requests to AWS CodePipeline.
service/codepipeline/codepipelineiface	Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
service/codestar	Package codestar provides the client and types for making API requests to AWS CodeStar.
service/codestar/codestariface	Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
service/cognitoidentity	Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
service/cognitoidentity/cognitoidentityiface	Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
service/cognitoidentityprovider	Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
service/cognitoidentityprovider/cognitoidentityprovideriface	Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
service/cognitosync	Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
service/cognitosync/cognitosynciface	Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
service/comprehend	Package comprehend provides the client and types for making API requests to Amazon Comprehend.
service/comprehend/comprehendiface	Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
service/comprehendmedical	Package comprehendmedical provides the client and types for making API requests to AWS Comprehend Medical.
service/comprehendmedical/comprehendmedicaliface	Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
service/configservice	Package configservice provides the client and types for making API requests to AWS Config.
service/configservice/configserviceiface	Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
service/connect	Package connect provides the client and types for making API requests to Amazon Connect Service.
service/connect/connectiface	Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
service/costandusagereportservice	Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
service/costandusagereportservice/costandusagereportserviceiface	Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
service/costexplorer	Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
service/costexplorer/costexploreriface	Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
service/databasemigrationservice	Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
service/databasemigrationservice/databasemigrationserviceiface	Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
service/datapipeline	Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
service/datapipeline/datapipelineiface	Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
service/datasync	Package datasync provides the client and types for making API requests to AWS DataSync.
service/datasync/datasynciface	Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
service/dax	Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
service/dax/daxiface	Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
service/devicefarm	Package devicefarm provides the client and types for making API requests to AWS Device Farm.
service/devicefarm/devicefarmiface	Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
service/directconnect	Package directconnect provides the client and types for making API requests to AWS Direct Connect.
service/directconnect/directconnectiface	Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
service/directoryservice	Package directoryservice provides the client and types for making API requests to AWS Directory Service.
service/directoryservice/directoryserviceiface	Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
service/dlm	Package dlm provides the client and types for making API requests to Amazon Data Lifecycle Manager.
service/dlm/dlmiface	Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
service/docdb	Package docdb provides the client and types for making API requests to Amazon DocumentDB with MongoDB compatibility.
service/docdb/docdbiface	Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
service/dynamodb	Package dynamodb provides the client and types for making API requests to Amazon DynamoDB.
service/dynamodb/dynamodbattribute	Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
service/dynamodb/dynamodbiface	Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
service/dynamodb/expression	Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
service/dynamodbstreams	Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
service/dynamodbstreams/dynamodbstreamsiface	Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
service/ec2	Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
service/ec2/ec2iface	Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
service/ec2instanceconnect	Package ec2instanceconnect provides the client and types for making API requests to AWS EC2 Instance Connect.
service/ec2instanceconnect/ec2instanceconnectiface	Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
service/ecr	Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
service/ecr/ecriface	Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
service/ecs	Package ecs provides the client and types for making API requests to Amazon EC2 Container Service.
service/ecs/ecsiface	Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
service/efs	Package efs provides the client and types for making API requests to Amazon Elastic File System.
service/efs/efsiface	Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
service/eks	Package eks provides the client and types for making API requests to Amazon Elastic Kubernetes Service.
service/eks/eksiface	Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
service/elasticache	Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
service/elasticache/elasticacheiface	Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
service/elasticbeanstalk	Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
service/elasticbeanstalk/elasticbeanstalkiface	Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
service/elasticsearchservice	Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
service/elasticsearchservice/elasticsearchserviceiface	Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
service/elastictranscoder	Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
service/elastictranscoder/elastictranscoderiface	Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
service/elb	Package elb provides the client and types for making API requests to Elastic Load Balancing.
service/elb/elbiface	Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
service/elbv2	Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
service/elbv2/elbv2iface	Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
service/emr	Package emr provides the client and types for making API requests to Amazon Elastic MapReduce.
service/emr/emriface	Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
service/eventbridge	Package eventbridge provides the client and types for making API requests to Amazon EventBridge.
service/eventbridge/eventbridgeiface	Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
service/firehose	Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
service/firehose/firehoseiface	Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
service/fms	Package fms provides the client and types for making API requests to Firewall Management Service.
service/fms/fmsiface	Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
service/fsx	Package fsx provides the client and types for making API requests to Amazon FSx.
service/fsx/fsxiface	Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
service/gamelift	Package gamelift provides the client and types for making API requests to Amazon GameLift.
service/gamelift/gameliftiface	Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
service/glacier	Package glacier provides the client and types for making API requests to Amazon Glacier.
service/glacier/glacieriface	Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
service/globalaccelerator	Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
service/globalaccelerator/globalacceleratoriface	Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
service/glue	Package glue provides the client and types for making API requests to AWS Glue.
service/glue/glueiface	Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
service/greengrass	Package greengrass provides the client and types for making API requests to AWS Greengrass.
service/greengrass/greengrassiface	Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
service/groundstation	Package groundstation provides the client and types for making API requests to AWS Ground Station.
service/groundstation/groundstationiface	Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
service/guardduty	Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
service/guardduty/guarddutyiface	Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
service/health	Package health provides the client and types for making API requests to AWS Health APIs and Notifications.
service/health/healthiface	Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
service/iam	Package iam provides the client and types for making API requests to AWS Identity and Access Management.
service/iam/iamiface	Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
service/inspector	Package inspector provides the client and types for making API requests to Amazon Inspector.
service/inspector/inspectoriface	Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
service/iot	Package iot provides the client and types for making API requests to AWS IoT.
service/iot1clickdevicesservice	Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
service/iot1clickdevicesservice/iot1clickdevicesserviceiface	Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
service/iot1clickprojects	Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
service/iot1clickprojects/iot1clickprojectsiface	Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
service/iotanalytics	Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
service/iotanalytics/iotanalyticsiface	Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
service/iotdataplane	Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
service/iotdataplane/iotdataplaneiface	Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
service/iotevents	Package iotevents provides the client and types for making API requests to AWS IoT Events.
service/ioteventsdata	Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
service/ioteventsdata/ioteventsdataiface	Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
service/iotevents/ioteventsiface	Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
service/iot/iotiface	Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
service/iotjobsdataplane	Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
service/iotjobsdataplane/iotjobsdataplaneiface	Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
service/iotthingsgraph	Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
service/iotthingsgraph/iotthingsgraphiface	Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
service/kafka	Package kafka provides the client and types for making API requests to Managed Streaming for Kafka.
service/kafka/kafkaiface	Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
service/kinesis	Package kinesis provides the client and types for making API requests to Amazon Kinesis.
service/kinesisanalytics	Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
service/kinesisanalytics/kinesisanalyticsiface	Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
service/kinesisanalyticsv2	Package kinesisanalyticsv2 provides the client and types for making API requests to Amazon Kinesis Analytics.
service/kinesisanalyticsv2/kinesisanalyticsv2iface	Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
service/kinesis/kinesisiface	Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
service/kinesisvideo	Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
service/kinesisvideoarchivedmedia	Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
service/kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface	Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
service/kinesisvideo/kinesisvideoiface	Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
service/kinesisvideomedia	Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
service/kinesisvideomedia/kinesisvideomediaiface	Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
service/kms	Package kms provides the client and types for making API requests to AWS Key Management Service.
service/kms/kmsiface	Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
service/lakeformation	Package lakeformation provides the client and types for making API requests to AWS Lake Formation.
service/lakeformation/lakeformationiface	Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
service/lambda	Package lambda provides the client and types for making API requests to AWS Lambda.
service/lambda/lambdaiface	Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
service/lexmodelbuildingservice	Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
service/lexmodelbuildingservice/lexmodelbuildingserviceiface	Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
service/lexruntimeservice	Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
service/lexruntimeservice/lexruntimeserviceiface	Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
service/licensemanager	Package licensemanager provides the client and types for making API requests to AWS License Manager.
service/licensemanager/licensemanageriface	Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
service/lightsail	Package lightsail provides the client and types for making API requests to Amazon Lightsail.
service/lightsail/lightsailiface	Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
service/machinelearning	Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
service/machinelearning/machinelearningiface	Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
service/macie	Package macie provides the client and types for making API requests to Amazon Macie.
service/macie/macieiface	Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
service/managedblockchain	Package managedblockchain provides the client and types for making API requests to Amazon Managed Blockchain.
service/managedblockchain/managedblockchainiface	Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
service/marketplacecommerceanalytics	Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
service/marketplacecommerceanalytics/marketplacecommerceanalyticsiface	Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
service/marketplaceentitlementservice	Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
service/marketplaceentitlementservice/marketplaceentitlementserviceiface	Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
service/marketplacemetering	Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
service/marketplacemetering/marketplacemeteringiface	Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
service/mediaconnect	Package mediaconnect provides the client and types for making API requests to AWS MediaConnect.
service/mediaconnect/mediaconnectiface	Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
service/mediaconvert	Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
service/mediaconvert/mediaconvertiface	Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
service/medialive	Package medialive provides the client and types for making API requests to AWS Elemental MediaLive.
service/medialive/medialiveiface	Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
service/mediapackage	Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
service/mediapackage/mediapackageiface	Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
service/mediapackagevod	Package mediapackagevod provides the client and types for making API requests to AWS Elemental MediaPackage VOD.
service/mediapackagevod/mediapackagevodiface	Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
service/mediastore	Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
service/mediastoredata	Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
service/mediastoredata/mediastoredataiface	Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
service/mediastore/mediastoreiface	Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
service/mediatailor	Package mediatailor provides the client and types for making API requests to AWS MediaTailor.
service/mediatailor/mediatailoriface	Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
service/migrationhub	Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
service/migrationhub/migrationhubiface	Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
service/mobile	Package mobile provides the client and types for making API requests to AWS Mobile.
service/mobileanalytics	Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
service/mobileanalytics/mobileanalyticsiface	Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
service/mobile/mobileiface	Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
service/mq	Package mq provides the client and types for making API requests to AmazonMQ.
service/mq/mqiface	Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
service/mturk	Package mturk provides the client and types for making API requests to Amazon Mechanical Turk.
service/mturk/mturkiface	Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
service/neptune	Package neptune provides the client and types for making API requests to Amazon Neptune.
service/neptune/neptuneiface	Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
service/opsworks	Package opsworks provides the client and types for making API requests to AWS OpsWorks.
service/opsworkscm	Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.
service/opsworkscm/opsworkscmiface	Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
service/opsworks/opsworksiface	Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
service/organizations	Package organizations provides the client and types for making API requests to AWS Organizations.
service/organizations/organizationsiface	Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
service/personalize	Package personalize provides the client and types for making API requests to Amazon Personalize.
service/personalizeevents	Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
service/personalizeevents/personalizeeventsiface	Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
service/personalize/personalizeiface	Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
service/personalizeruntime	Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
service/personalizeruntime/personalizeruntimeiface	Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
service/pi	Package pi provides the client and types for making API requests to AWS Performance Insights.
service/pinpoint	Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
service/pinpointemail	Package pinpointemail provides the client and types for making API requests to Amazon Pinpoint Email Service.
service/pinpointemail/pinpointemailiface	Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
service/pinpoint/pinpointiface	Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
service/pinpointsmsvoice	Package pinpointsmsvoice provides the client and types for making API requests to Amazon Pinpoint SMS and Voice Service.
service/pinpointsmsvoice/pinpointsmsvoiceiface	Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
service/pi/piiface	Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
service/polly	Package polly provides the client and types for making API requests to Amazon Polly.
service/polly/pollyiface	Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
service/pricing	Package pricing provides the client and types for making API requests to AWS Price List Service.
service/pricing/pricingiface	Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
service/quicksight	Package quicksight provides the client and types for making API requests to Amazon QuickSight.
service/quicksight/quicksightiface	Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
service/ram	Package ram provides the client and types for making API requests to AWS Resource Access Manager.
service/ram/ramiface	Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
service/rds	Package rds provides the client and types for making API requests to Amazon Relational Database Service.
service/rdsdataservice	Package rdsdataservice provides the client and types for making API requests to AWS RDS DataService.
service/rdsdataservice/rdsdataserviceiface	Package rdsdataserviceiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
service/rds/rdsiface	Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
service/rds/rdsutils	Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
service/redshift	Package redshift provides the client and types for making API requests to Amazon Redshift.
service/redshift/redshiftiface	Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
service/rekognition	Package rekognition provides the client and types for making API requests to Amazon Rekognition.
service/rekognition/rekognitioniface	Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
service/resourcegroups	Package resourcegroups provides the client and types for making API requests to AWS Resource Groups.
service/resourcegroups/resourcegroupsiface	Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
service/resourcegroupstaggingapi	Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
service/resourcegroupstaggingapi/resourcegroupstaggingapiiface	Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
service/robomaker	Package robomaker provides the client and types for making API requests to AWS RoboMaker.
service/robomaker/robomakeriface	Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
service/route53	Package route53 provides the client and types for making API requests to Amazon Route 53.
service/route53domains	Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
service/route53domains/route53domainsiface	Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
service/route53resolver	Package route53resolver provides the client and types for making API requests to Amazon Route 53 Resolver.
service/route53resolver/route53resolveriface	Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
service/route53/route53iface	Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
service/s3	Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
service/s3control	Package s3control provides the client and types for making API requests to AWS S3 Control.
service/s3control/s3controliface	Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
service/s3/s3crypto	Package s3crypto provides encryption to S3 using KMS and AES GCM.
service/s3/s3iface	Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
service/s3/s3manager	Package s3manager provides utilities to upload and download objects from S3 concurrently.
service/s3/s3manager/s3manageriface	Package s3manageriface provides an interface for the s3manager package
service/sagemaker	Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
service/sagemakerruntime	Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
service/sagemakerruntime/sagemakerruntimeiface	Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
service/sagemaker/sagemakeriface	Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
service/secretsmanager	Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
service/secretsmanager/secretsmanageriface	Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
service/securityhub	Package securityhub provides the client and types for making API requests to AWS SecurityHub.
service/securityhub/securityhubiface	Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
service/serverlessapplicationrepository	Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
service/serverlessapplicationrepository/serverlessapplicationrepositoryiface	Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
service/servicecatalog	Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
service/servicecatalog/servicecatalogiface	Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
service/servicediscovery	Package servicediscovery provides the client and types for making API requests to AWS Cloud Map.
service/servicediscovery/servicediscoveryiface	Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
service/servicequotas	Package servicequotas provides the client and types for making API requests to Service Quotas.
service/servicequotas/servicequotasiface	Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
service/ses	Package ses provides the client and types for making API requests to Amazon Simple Email Service.
service/ses/sesiface	Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
service/sfn	Package sfn provides the client and types for making API requests to AWS Step Functions.
service/sfn/sfniface	Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
service/shield	Package shield provides the client and types for making API requests to AWS Shield.
service/shield/shieldiface	Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
service/signer	Package signer provides the client and types for making API requests to AWS Signer.
service/signer/signeriface	Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
service/simpledb	Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
service/simpledb/simpledbiface	Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
service/sms	Package sms provides the client and types for making API requests to AWS Server Migration Service.
service/sms/smsiface	Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
service/snowball	Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
service/snowball/snowballiface	Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
service/sns	Package sns provides the client and types for making API requests to Amazon Simple Notification Service.
service/sns/snsiface	Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
service/sqs	Package sqs provides the client and types for making API requests to Amazon Simple Queue Service.
service/sqs/sqsiface	Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
service/ssm	Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
service/ssm/ssmiface	Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
service/storagegateway	Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
service/storagegateway/storagegatewayiface	Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
service/sts	Package sts provides the client and types for making API requests to AWS Security Token Service.
service/sts/stsiface	Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
service/support	Package support provides the client and types for making API requests to AWS Support.
service/support/supportiface	Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
service/swf	Package swf provides the client and types for making API requests to Amazon Simple Workflow Service.
service/swf/swfiface	Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
service/textract	Package textract provides the client and types for making API requests to Amazon Textract.
service/textract/textractiface	Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
service/transcribeservice	Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
service/transcribeservice/transcribeserviceiface	Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
service/transfer	Package transfer provides the client and types for making API requests to AWS Transfer for SFTP.
service/transfer/transferiface	Package transferiface provides an interface to enable mocking the AWS Transfer for SFTP service client for testing your code.
service/translate	Package translate provides the client and types for making API requests to Amazon Translate.
service/translate/translateiface	Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
service/waf	Package waf provides the client and types for making API requests to AWS WAF.
service/wafregional	Package wafregional provides the client and types for making API requests to AWS WAF Regional.
service/wafregional/wafregionaliface	Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
service/waf/wafiface	Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
service/workdocs	Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
service/workdocs/workdocsiface	Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
service/worklink	Package worklink provides the client and types for making API requests to Amazon WorkLink.
service/worklink/worklinkiface	Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
service/workmail	Package workmail provides the client and types for making API requests to Amazon WorkMail.
service/workmail/workmailiface	Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
service/workspaces	Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
service/workspaces/workspacesiface	Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
service/xray	Package xray provides the client and types for making API requests to AWS X-Ray.
service/xray/xrayiface	Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.