package sdk

import "github.com/aws/aws-sdk-go-v2"

Package sdk is the official AWS SDK v2 for the Go programming language.

aws-sdk-go-v2 is the Developer Preview for the v2 of the AWS SDK for the Go programming language. Look for additional documentation and examples to be added.

Getting started ¶

The best way to get started working with the SDK is to use `go get` to add the SDK to your Go Workspace manually.

go get github.com/aws/aws-sdk-go-v2

You could also use [Dep] to add the SDK to your application's dependencies. Using [Dep] will simplify your update story and help your application keep pinned to specific version of the SDK

dep ensure --add github.com/aws/aws-sdk-go-v2

Hello AWS ¶

This example shows how you can use the v2 SDK to make an API request using the SDK's Amazon DynamoDB client.

package main

import (
	"context"
	"github.com/aws/aws-sdk-go-v2/aws"
	"github.com/aws/aws-sdk-go-v2/aws/endpoints"
	"github.com/aws/aws-sdk-go-v2/aws/external"
	"github.com/aws/aws-sdk-go-v2/service/dynamodb"
)

func main() {
	// Using the SDK's default configuration, loading additional config
	// and credentials values from the environment variables, shared
	// credentials, and shared configuration files
	cfg, err := external.LoadDefaultAWSConfig()
	if err != nil {
		panic("unable to load SDK config, " + err.Error())
	}

	// Set the AWS Region that the service clients should use
	cfg.Region = endpoints.UsWest2RegionID

	// Using the Config value, create the DynamoDB client
	svc := dynamodb.New(cfg)

	// Build the request with its input parameters
	req := svc.DescribeTableRequest(&dynamodb.DescribeTableInput{
		TableName: aws.String("myTable"),
	})

	// Send the request, and get the response or error back
	resp, err := req.Send(context.Background())
	if err != nil {
		panic("failed to describe table, "+err.Error())
	}

	fmt.Println("Response", resp)
}

Index ¶

Package Files ¶

doc.go

Directories ¶

Path	Synopsis
aws	Package aws provides the core SDK's utilities and shared types.
aws/arn	Package arn provides a parser for interacting with Amazon Resource Names.
aws/awserr	Package awserr represents API error interface accessors for the SDK.
aws/defaults	Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.
aws/ec2metadata	Package ec2metadata provides the client for making API calls to the EC2 Instance Metadata service.
aws/ec2rolecreds
aws/endpointcreds	Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.
aws/endpoints	Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.
aws/external
aws/signer/v2
aws/signer/v4	Package v4 implements signing for AWS V4 signer
aws/stscreds	Package stscreds are credential Providers to retrieve STS AWS credentials.
internal/awstesting
internal/awstesting/mock
internal/awstesting/unit	Package unit performs initialization and validation for unit tests
internal/awsutil
internal/ini	Package ini is an LL(1) parser for configuration files.
internal/s3err
internal/sdk
internal/sdkio
internal/shareddefaults
private/model/api
private/protocol
private/protocol/ec2query	Package ec2query provides serialization of AWS EC2 requests and responses.
private/protocol/json
private/protocol/json/jsonutil	Package jsonutil provides JSON serialization of AWS requests and responses.
private/protocol/jsonrpc	Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses.
private/protocol/query	Package query provides serialization of AWS query requests, and responses.
private/protocol/query/queryutil
private/protocol/rest	Package rest provides RESTful serialization of AWS requests and responses.
private/protocol/restjson	Package restjson provides RESTful JSON serialization of AWS requests and responses.
private/protocol/restxml	Package restxml provides RESTful XML serialization of AWS requests and responses.
private/protocol/xml
private/protocol/xml/xmlutil	Package xmlutil provides XML serialization of AWS requests and responses.
private/util
service	Package service contains automatically generated AWS clients.
service/accessanalyzer	Package accessanalyzer provides the client and types for making API requests to Access Analyzer.
service/accessanalyzer/accessanalyzeriface	Package accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
service/acm	Package acm provides the client and types for making API requests to ACM.
service/acm/acmiface	Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
service/acmpca	Package acmpca provides the client and types for making API requests to ACM-PCA.
service/acmpca/acmpcaiface	Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
service/alexaforbusiness	Package alexaforbusiness provides the client and types for making API requests to Alexa For Business.
service/alexaforbusiness/alexaforbusinessiface	Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
service/amplify	Package amplify provides the client and types for making API requests to Amplify.
service/amplify/amplifyiface	Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
service/apigateway	Package apigateway provides the client and types for making API requests to Amazon API Gateway.
service/apigateway/apigatewayiface	Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
service/apigatewaymanagementapi	Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
service/apigatewaymanagementapi/apigatewaymanagementapiiface	Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
service/apigatewayv2	Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
service/apigatewayv2/apigatewayv2iface	Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
service/appconfig	Package appconfig provides the client and types for making API requests to AppConfig.
service/appconfig/appconfigiface	Package appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
service/applicationautoscaling	Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
service/applicationautoscaling/applicationautoscalingiface	Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
service/applicationdiscoveryservice	Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
service/applicationdiscoveryservice/applicationdiscoveryserviceiface	Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
service/applicationinsights	Package applicationinsights provides the client and types for making API requests to Application Insights.
service/applicationinsights/applicationinsightsiface	Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
service/appmesh	Package appmesh provides the client and types for making API requests to AWS App Mesh.
service/appmesh/appmeshiface	Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
service/appstream	Package appstream provides the client and types for making API requests to Amazon AppStream.
service/appstream/appstreamiface	Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
service/appsync	Package appsync provides the client and types for making API requests to AWSAppSync.
service/appsync/appsynciface	Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
service/athena	Package athena provides the client and types for making API requests to Amazon Athena.
service/athena/athenaiface	Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
service/autoscaling	Package autoscaling provides the client and types for making API requests to Auto Scaling.
service/autoscaling/autoscalingiface	Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
service/autoscalingplans	Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
service/autoscalingplans/autoscalingplansiface	Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
service/backup	Package backup provides the client and types for making API requests to AWS Backup.
service/backup/backupiface	Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
service/batch	Package batch provides the client and types for making API requests to AWS Batch.
service/batch/batchiface	Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
service/budgets	Package budgets provides the client and types for making API requests to AWSBudgets.
service/budgets/budgetsiface	Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
service/chime	Package chime provides the client and types for making API requests to Amazon Chime.
service/chime/chimeiface	Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
service/cloud9	Package cloud9 provides the client and types for making API requests to AWS Cloud9.
service/cloud9/cloud9iface	Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
service/clouddirectory	Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
service/clouddirectory/clouddirectoryiface	Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
service/cloudformation	Package cloudformation provides the client and types for making API requests to AWS CloudFormation.
service/cloudformation/cloudformationiface	Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
service/cloudfront	Package cloudfront provides the client and types for making API requests to CloudFront.
service/cloudfront/cloudfrontiface	Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
service/cloudfront/sign	Package sign provides utilities to generate signed URLs for Amazon CloudFront.
service/cloudhsm	Package cloudhsm provides the client and types for making API requests to CloudHSM.
service/cloudhsm/cloudhsmiface	Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
service/cloudhsmv2	Package cloudhsmv2 provides the client and types for making API requests to CloudHSM V2.
service/cloudhsmv2/cloudhsmv2iface	Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
service/cloudsearch	Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
service/cloudsearch/cloudsearchiface	Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
service/cloudsearchdomain	Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
service/cloudsearchdomain/cloudsearchdomainiface	Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
service/cloudtrail	Package cloudtrail provides the client and types for making API requests to CloudTrail.
service/cloudtrail/cloudtrailiface	Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
service/cloudwatch	Package cloudwatch provides the client and types for making API requests to CloudWatch.
service/cloudwatch/cloudwatchiface	Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
service/cloudwatchevents	Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
service/cloudwatchevents/cloudwatcheventsiface	Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
service/cloudwatchlogs	Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
service/cloudwatchlogs/cloudwatchlogsiface	Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
service/codebuild	Package codebuild provides the client and types for making API requests to AWS CodeBuild.
service/codebuild/codebuildiface	Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
service/codecommit	Package codecommit provides the client and types for making API requests to CodeCommit.
service/codecommit/codecommitiface	Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
service/codedeploy	Package codedeploy provides the client and types for making API requests to CodeDeploy.
service/codedeploy/codedeployiface	Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
service/codeguruprofiler	Package codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
service/codeguruprofiler/codeguruprofileriface	Package codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
service/codegurureviewer	Package codegurureviewer provides the client and types for making API requests to CodeGuruReviewer.
service/codegurureviewer/codegururevieweriface	Package codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
service/codepipeline	Package codepipeline provides the client and types for making API requests to CodePipeline.
service/codepipeline/codepipelineiface	Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
service/codestar	Package codestar provides the client and types for making API requests to CodeStar.
service/codestar/codestariface	Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
service/codestarnotifications	Package codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
service/codestarnotifications/codestarnotificationsiface	Package codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
service/cognitoidentity	Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
service/cognitoidentity/cognitoidentityiface	Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
service/cognitoidentityprovider	Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
service/cognitoidentityprovider/cognitoidentityprovideriface	Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
service/cognitosync	Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
service/cognitosync/cognitosynciface	Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
service/comprehend	Package comprehend provides the client and types for making API requests to Amazon Comprehend.
service/comprehend/comprehendiface	Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
service/comprehendmedical	Package comprehendmedical provides the client and types for making API requests to ComprehendMedical.
service/comprehendmedical/comprehendmedicaliface	Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
service/computeoptimizer	Package computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
service/computeoptimizer/computeoptimizeriface	Package computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
service/configservice	Package configservice provides the client and types for making API requests to Config Service.
service/configservice/configserviceiface	Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
service/connect	Package connect provides the client and types for making API requests to Amazon Connect.
service/connect/connectiface	Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
service/connectparticipant	Package connectparticipant provides the client and types for making API requests to Amazon Connect Participant.
service/costandusagereportservice	Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
service/costandusagereportservice/costandusagereportserviceiface	Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
service/costexplorer	Package costexplorer provides the client and types for making API requests to AWS Cost Explorer.
service/costexplorer/costexploreriface	Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
service/databasemigrationservice	Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
service/databasemigrationservice/databasemigrationserviceiface	Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
service/dataexchange	Package dataexchange provides the client and types for making API requests to AWS Data Exchange.
service/dataexchange/dataexchangeiface	Package dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
service/datapipeline	Package datapipeline provides the client and types for making API requests to AWS Data Pipeline.
service/datapipeline/datapipelineiface	Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
service/datasync	Package datasync provides the client and types for making API requests to DataSync.
service/datasync/datasynciface	Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
service/dax	Package dax provides the client and types for making API requests to Amazon DAX.
service/dax/daxiface	Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
service/devicefarm	Package devicefarm provides the client and types for making API requests to AWS Device Farm.
service/devicefarm/devicefarmiface	Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
service/directconnect	Package directconnect provides the client and types for making API requests to AWS Direct Connect.
service/directconnect/directconnectiface	Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
service/directoryservice	Package directoryservice provides the client and types for making API requests to Directory Service.
service/directoryservice/directoryserviceiface	Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
service/dlm	Package dlm provides the client and types for making API requests to Amazon DLM.
service/dlm/dlmiface	Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
service/docdb	Package docdb provides the client and types for making API requests to Amazon DocDB.
service/docdb/docdbiface	Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
service/dynamodb	Package dynamodb provides the client and types for making API requests to DynamoDB.
service/dynamodb/dynamodbattribute	Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
service/dynamodb/dynamodbiface	Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
service/dynamodb/expression	Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
service/dynamodbstreams	Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
service/dynamodbstreams/dynamodbstreamsiface	Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
service/ebs	Package ebs provides the client and types for making API requests to Amazon EBS.
service/ebs/ebsiface	Package ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
service/ec2	Package ec2 provides the client and types for making API requests to Amazon EC2.
service/ec2/ec2iface	Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
service/ec2instanceconnect	Package ec2instanceconnect provides the client and types for making API requests to EC2 Instance Connect.
service/ec2instanceconnect/ec2instanceconnectiface	Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
service/ecr	Package ecr provides the client and types for making API requests to Amazon ECR.
service/ecr/ecriface	Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
service/ecs	Package ecs provides the client and types for making API requests to Amazon ECS.
service/ecs/ecsiface	Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
service/efs	Package efs provides the client and types for making API requests to EFS.
service/efs/efsiface	Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
service/eks	Package eks provides the client and types for making API requests to Amazon EKS.
service/eks/eksiface	Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
service/elasticache	Package elasticache provides the client and types for making API requests to Amazon ElastiCache.
service/elasticache/elasticacheiface	Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
service/elasticbeanstalk	Package elasticbeanstalk provides the client and types for making API requests to Elastic Beanstalk.
service/elasticbeanstalk/elasticbeanstalkiface	Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
service/elasticinference	Package elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
service/elasticinference/elasticinferenceiface	Package elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
service/elasticloadbalancing	Package elasticloadbalancing provides the client and types for making API requests to Elastic Load Balancing.
service/elasticloadbalancing/elasticloadbalancingiface	Package elasticloadbalancingiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
service/elasticloadbalancingv2	Package elasticloadbalancingv2 provides the client and types for making API requests to Elastic Load Balancing v2.
service/elasticloadbalancingv2/elasticloadbalancingv2iface	Package elasticloadbalancingv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
service/elasticsearchservice	Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
service/elasticsearchservice/elasticsearchserviceiface	Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
service/elastictranscoder	Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
service/elastictranscoder/elastictranscoderiface	Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
service/emr	Package emr provides the client and types for making API requests to Amazon EMR.
service/emr/emriface	Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
service/eventbridge	Package eventbridge provides the client and types for making API requests to Amazon EventBridge.
service/eventbridge/eventbridgeiface	Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
service/firehose	Package firehose provides the client and types for making API requests to Firehose.
service/firehose/firehoseiface	Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
service/fms	Package fms provides the client and types for making API requests to FMS.
service/fms/fmsiface	Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
service/forecast	Package forecast provides the client and types for making API requests to Amazon Forecast Service.
service/forecast/forecastiface	Package forecastiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
service/forecastquery	Package forecastquery provides the client and types for making API requests to Amazon Forecast Query Service.
service/forecastquery/forecastqueryiface	Package forecastqueryiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
service/frauddetector	Package frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
service/frauddetector/frauddetectoriface	Package frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
service/fsx	Package fsx provides the client and types for making API requests to Amazon FSx.
service/fsx/fsxiface	Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
service/gamelift	Package gamelift provides the client and types for making API requests to Amazon GameLift.
service/gamelift/gameliftiface	Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
service/glacier	Package glacier provides the client and types for making API requests to Amazon Glacier.
service/glacier/glacieriface	Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
service/globalaccelerator	Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
service/globalaccelerator/globalacceleratoriface	Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
service/glue	Package glue provides the client and types for making API requests to AWS Glue.
service/glue/glueiface	Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
service/greengrass	Package greengrass provides the client and types for making API requests to AWS Greengrass.
service/greengrass/greengrassiface	Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
service/groundstation	Package groundstation provides the client and types for making API requests to AWS Ground Station.
service/groundstation/groundstationiface	Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
service/guardduty	Package guardduty provides the client and types for making API requests to Amazon GuardDuty.
service/guardduty/guarddutyiface	Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
service/health	Package health provides the client and types for making API requests to AWSHealth.
service/health/healthiface	Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
service/iam	Package iam provides the client and types for making API requests to IAM.
service/iam/iamiface	Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
service/imagebuilder	Package imagebuilder provides the client and types for making API requests to imagebuilder.
service/inspector	Package inspector provides the client and types for making API requests to Amazon Inspector.
service/inspector/inspectoriface	Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
service/iot	Package iot provides the client and types for making API requests to AWS IoT.
service/iot1clickdevicesservice	Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
service/iot1clickdevicesservice/iot1clickdevicesserviceiface	Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
service/iot1clickprojects	Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects.
service/iot1clickprojects/iot1clickprojectsiface	Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
service/iotanalytics	Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
service/iotanalytics/iotanalyticsiface	Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
service/iotdataplane	Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
service/iotdataplane/iotdataplaneiface	Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
service/iotevents	Package iotevents provides the client and types for making API requests to AWS IoT Events.
service/ioteventsdata	Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
service/ioteventsdata/ioteventsdataiface	Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
service/iotevents/ioteventsiface	Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
service/iot/iotiface	Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
service/iotjobsdataplane	Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
service/iotjobsdataplane/iotjobsdataplaneiface	Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
service/iotsecuretunneling	Package iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
service/iotsecuretunneling/iotsecuretunnelingiface	Package iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
service/iotthingsgraph	Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
service/iotthingsgraph/iotthingsgraphiface	Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
service/kafka	Package kafka provides the client and types for making API requests to Kafka.
service/kafka/kafkaiface	Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
service/kendra	Package kendra provides the client and types for making API requests to kendra.
service/kendra/kendraiface	Package kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
service/kinesis	Package kinesis provides the client and types for making API requests to Kinesis.
service/kinesisanalytics	Package kinesisanalytics provides the client and types for making API requests to Kinesis Analytics.
service/kinesisanalytics/kinesisanalyticsiface	Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
service/kinesisanalyticsv2	Package kinesisanalyticsv2 provides the client and types for making API requests to Kinesis Analytics V2.
service/kinesisanalyticsv2/kinesisanalyticsv2iface	Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
service/kinesis/kinesisiface	Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
service/kinesisvideo	Package kinesisvideo provides the client and types for making API requests to Kinesis Video.
service/kinesisvideoarchivedmedia	Package kinesisvideoarchivedmedia provides the client and types for making API requests to Kinesis Video Archived Media.
service/kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface	Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
service/kinesisvideo/kinesisvideoiface	Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
service/kinesisvideomedia	Package kinesisvideomedia provides the client and types for making API requests to Kinesis Video Media.
service/kinesisvideomedia/kinesisvideomediaiface	Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
service/kinesisvideosignaling	Package kinesisvideosignaling provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
service/kinesisvideosignaling/kinesisvideosignalingiface	Package kinesisvideosignalingiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
service/kms	Package kms provides the client and types for making API requests to KMS.
service/kms/kmsiface	Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
service/lakeformation	Package lakeformation provides the client and types for making API requests to AWS Lake Formation.
service/lakeformation/lakeformationiface	Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
service/lambda	Package lambda provides the client and types for making API requests to AWS Lambda.
service/lambda/lambdaiface	Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
service/lexmodelbuildingservice	Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
service/lexmodelbuildingservice/lexmodelbuildingserviceiface	Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
service/lexruntimeservice	Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
service/lexruntimeservice/lexruntimeserviceiface	Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
service/licensemanager	Package licensemanager provides the client and types for making API requests to AWS License Manager.
service/licensemanager/licensemanageriface	Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
service/lightsail	Package lightsail provides the client and types for making API requests to Amazon Lightsail.
service/lightsail/lightsailiface	Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
service/machinelearning	Package machinelearning provides the client and types for making API requests to Amazon Machine Learning.
service/machinelearning/machinelearningiface	Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
service/macie	Package macie provides the client and types for making API requests to Amazon Macie.
service/macie/macieiface	Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
service/managedblockchain	Package managedblockchain provides the client and types for making API requests to ManagedBlockchain.
service/managedblockchain/managedblockchainiface	Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
service/marketplacecatalog	Package marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog.
service/marketplacecatalog/marketplacecatalogiface	Package marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
service/marketplacecommerceanalytics	Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
service/marketplacecommerceanalytics/marketplacecommerceanalyticsiface	Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
service/marketplaceentitlementservice	Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
service/marketplaceentitlementservice/marketplaceentitlementserviceiface	Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
service/marketplacemetering	Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
service/marketplacemetering/marketplacemeteringiface	Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
service/mediaconnect	Package mediaconnect provides the client and types for making API requests to AWS MediaConnect.
service/mediaconnect/mediaconnectiface	Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
service/mediaconvert	Package mediaconvert provides the client and types for making API requests to MediaConvert.
service/mediaconvert/mediaconvertiface	Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
service/medialive	Package medialive provides the client and types for making API requests to MediaLive.
service/medialive/medialiveiface	Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
service/mediapackage	Package mediapackage provides the client and types for making API requests to MediaPackage.
service/mediapackage/mediapackageiface	Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
service/mediapackagevod	Package mediapackagevod provides the client and types for making API requests to MediaPackage Vod.
service/mediapackagevod/mediapackagevodiface	Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
service/mediastore	Package mediastore provides the client and types for making API requests to MediaStore.
service/mediastoredata	Package mediastoredata provides the client and types for making API requests to MediaStore Data.
service/mediastoredata/mediastoredataiface	Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
service/mediastore/mediastoreiface	Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
service/mediatailor	Package mediatailor provides the client and types for making API requests to MediaTailor.
service/mediatailor/mediatailoriface	Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
service/migrationhub	Package migrationhub provides the client and types for making API requests to AWS Migration Hub.
service/migrationhubconfig	Package migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
service/migrationhubconfig/migrationhubconfigiface	Package migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
service/migrationhub/migrationhubiface	Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
service/mobile	Package mobile provides the client and types for making API requests to AWS Mobile.
service/mobileanalytics	Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
service/mobileanalytics/mobileanalyticsiface	Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
service/mobile/mobileiface	Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
service/mq	Package mq provides the client and types for making API requests to AmazonMQ.
service/mq/mqiface	Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
service/mturk	Package mturk provides the client and types for making API requests to Amazon MTurk.
service/mturk/mturkiface	Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
service/neptune	Package neptune provides the client and types for making API requests to Amazon Neptune.
service/neptune/neptuneiface	Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
service/networkmanager	Package networkmanager provides the client and types for making API requests to NetworkManager.
service/networkmanager/networkmanageriface	Package networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
service/opsworks	Package opsworks provides the client and types for making API requests to AWS OpsWorks.
service/opsworkscm	Package opsworkscm provides the client and types for making API requests to OpsWorksCM.
service/opsworkscm/opsworkscmiface	Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
service/opsworks/opsworksiface	Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
service/organizations	Package organizations provides the client and types for making API requests to Organizations.
service/organizations/organizationsiface	Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
service/outposts	Package outposts provides the client and types for making API requests to Outposts.
service/personalize	Package personalize provides the client and types for making API requests to Amazon Personalize.
service/personalizeevents	Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
service/personalizeevents/personalizeeventsiface	Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
service/personalize/personalizeiface	Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
service/personalizeruntime	Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
service/personalizeruntime/personalizeruntimeiface	Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
service/pi	Package pi provides the client and types for making API requests to AWS PI.
service/pinpoint	Package pinpoint provides the client and types for making API requests to Amazon Pinpoint.
service/pinpointemail	Package pinpointemail provides the client and types for making API requests to Pinpoint Email.
service/pinpointemail/pinpointemailiface	Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
service/pinpoint/pinpointiface	Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
service/pinpointsmsvoice	Package pinpointsmsvoice provides the client and types for making API requests to Pinpoint SMS Voice.
service/pinpointsmsvoice/pinpointsmsvoiceiface	Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
service/pi/piiface	Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
service/polly	Package polly provides the client and types for making API requests to Amazon Polly.
service/polly/pollyiface	Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
service/pricing	Package pricing provides the client and types for making API requests to AWS Pricing.
service/pricing/pricingiface	Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
service/qldb	Package qldb provides the client and types for making API requests to QLDB.
service/qldb/qldbiface	Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
service/qldbsession	Package qldbsession provides the client and types for making API requests to QLDB Session.
service/qldbsession/qldbsessioniface	Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
service/quicksight	Package quicksight provides the client and types for making API requests to Amazon QuickSight.
service/quicksight/quicksightiface	Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
service/ram	Package ram provides the client and types for making API requests to RAM.
service/ram/ramiface	Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
service/rds	Package rds provides the client and types for making API requests to Amazon RDS.
service/rdsdata	Package rdsdata provides the client and types for making API requests to AWS RDS DataService.
service/rdsdata/rdsdataiface	Package rdsdataiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
service/rds/rdsiface	Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
service/rds/rdsutils	Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
service/redshift	Package redshift provides the client and types for making API requests to Amazon Redshift.
service/redshift/redshiftiface	Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
service/rekognition	Package rekognition provides the client and types for making API requests to Amazon Rekognition.
service/rekognition/rekognitioniface	Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
service/resourcegroups	Package resourcegroups provides the client and types for making API requests to Resource Groups.
service/resourcegroups/resourcegroupsiface	Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
service/resourcegroupstaggingapi	Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
service/resourcegroupstaggingapi/resourcegroupstaggingapiiface	Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
service/robomaker	Package robomaker provides the client and types for making API requests to RoboMaker.
service/robomaker/robomakeriface	Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
service/route53	Package route53 provides the client and types for making API requests to Route 53.
service/route53domains	Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
service/route53domains/route53domainsiface	Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
service/route53resolver	Package route53resolver provides the client and types for making API requests to Route53Resolver.
service/route53resolver/route53resolveriface	Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
service/route53/route53iface	Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
service/s3	Package s3 provides the client and types for making API requests to Amazon S3.
service/s3control	Package s3control provides the client and types for making API requests to AWS S3 Control.
service/s3control/s3controliface	Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
service/s3/s3crypto	Package s3crypto is deprecated and may be removed from the future versions of the SDK.
service/s3/s3iface	Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
service/s3/s3manager	Package s3manager provides utilities to upload and download objects from S3 concurrently.
service/s3/s3manager/s3manageriface	Package s3manageriface provides an interface for the s3manager package
service/sagemaker	Package sagemaker provides the client and types for making API requests to SageMaker.
service/sagemakera2iruntime	Package sagemakera2iruntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
service/sagemakera2iruntime/sagemakera2iruntimeiface	Package sagemakera2iruntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
service/sagemakerruntime	Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
service/sagemakerruntime/sagemakerruntimeiface	Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
service/sagemaker/sagemakeriface	Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
service/savingsplans	Package savingsplans provides the client and types for making API requests to AWSSavingsPlans.
service/savingsplans/savingsplansiface	Package savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
service/schemas	Package schemas provides the client and types for making API requests to Schemas.
service/schemas/schemasiface	Package schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
service/secretsmanager	Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
service/secretsmanager/secretsmanageriface	Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
service/securityhub	Package securityhub provides the client and types for making API requests to AWS SecurityHub.
service/securityhub/securityhubiface	Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
service/serverlessapplicationrepository	Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
service/serverlessapplicationrepository/serverlessapplicationrepositoryiface	Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
service/servicecatalog	Package servicecatalog provides the client and types for making API requests to AWS Service Catalog.
service/servicecatalog/servicecatalogiface	Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
service/servicediscovery	Package servicediscovery provides the client and types for making API requests to ServiceDiscovery.
service/servicediscovery/servicediscoveryiface	Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
service/servicequotas	Package servicequotas provides the client and types for making API requests to Service Quotas.
service/servicequotas/servicequotasiface	Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
service/ses	Package ses provides the client and types for making API requests to Amazon SES.
service/ses/sesiface	Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
service/sesv2	Package sesv2 provides the client and types for making API requests to Amazon SES V2.
service/sesv2/sesv2iface	Package sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
service/sfn	Package sfn provides the client and types for making API requests to AWS SFN.
service/sfn/sfniface	Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
service/shield	Package shield provides the client and types for making API requests to AWS Shield.
service/shield/shieldiface	Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
service/signer	Package signer provides the client and types for making API requests to signer.
service/signer/signeriface	Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
service/simpledb	Package simpledb provides the client and types for making API requests to Amazon SimpleDB.
service/simpledb/simpledbiface	Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
service/sms	Package sms provides the client and types for making API requests to SMS.
service/sms/smsiface	Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
service/snowball	Package snowball provides the client and types for making API requests to Amazon Snowball.
service/snowball/snowballiface	Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
service/sns	Package sns provides the client and types for making API requests to Amazon SNS.
service/sns/snsiface	Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
service/sqs	Package sqs provides the client and types for making API requests to Amazon SQS.
service/sqs/sqsiface	Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
service/ssm	Package ssm provides the client and types for making API requests to Amazon SSM.
service/ssm/ssmiface	Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
service/sso	Package sso provides the client and types for making API requests to SSO.
service/ssooidc	Package ssooidc provides the client and types for making API requests to SSO OIDC.
service/ssooidc/ssooidciface	Package ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
service/sso/ssoiface	Package ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
service/storagegateway	Package storagegateway provides the client and types for making API requests to AWS Storage Gateway.
service/storagegateway/storagegatewayiface	Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
service/sts	Package sts provides the client and types for making API requests to AWS STS.
service/sts/stsiface	Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
service/support	Package support provides the client and types for making API requests to AWS Support.
service/support/supportiface	Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
service/swf	Package swf provides the client and types for making API requests to Amazon SWF.
service/swf/swfiface	Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
service/textract	Package textract provides the client and types for making API requests to Amazon Textract.
service/textract/textractiface	Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
service/transcribe	Package transcribe provides the client and types for making API requests to Amazon Transcribe Service.
service/transcribe/transcribeiface	Package transcribeiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
service/transfer	Package transfer provides the client and types for making API requests to AWS Transfer.
service/transfer/transferiface	Package transferiface provides an interface to enable mocking the AWS Transfer for SFTP service client for testing your code.
service/translate	Package translate provides the client and types for making API requests to Amazon Translate.
service/translate/translateiface	Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
service/waf	Package waf provides the client and types for making API requests to WAF.
service/wafregional	Package wafregional provides the client and types for making API requests to WAF Regional.
service/wafregional/wafregionaliface	Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
service/wafv2	Package wafv2 provides the client and types for making API requests to WAFV2.
service/wafv2/wafv2iface	Package wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
service/waf/wafiface	Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
service/workdocs	Package workdocs provides the client and types for making API requests to Amazon WorkDocs.
service/workdocs/workdocsiface	Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
service/worklink	Package worklink provides the client and types for making API requests to WorkLink.
service/worklink/worklinkiface	Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
service/workmail	Package workmail provides the client and types for making API requests to Amazon WorkMail.
service/workmailmessageflow	Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
service/workmailmessageflow/workmailmessageflowiface	Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
service/workmail/workmailiface	Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
service/workspaces	Package workspaces provides the client and types for making API requests to Amazon WorkSpaces.
service/workspaces/workspacesiface	Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
service/xray	Package xray provides the client and types for making API requests to AWS X-Ray.
service/xray/xrayiface	Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.