aws-sdk-go: github.com/aws/aws-sdk-go/service Index | Files | Directories

package service

import "github.com/aws/aws-sdk-go/service"

Package service contains automatically generated AWS clients.

Index

Package Files

generate.go

Directories

PathSynopsis
acmPackage acm provides the client and types for making API requests to AWS Certificate Manager.
acm/acmifacePackage acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
acmpcaPackage acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
acmpca/acmpcaifacePackage acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
alexaforbusinessPackage alexaforbusiness provides the client and types for making API requests to Alexa For Business.
alexaforbusiness/alexaforbusinessifacePackage alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
amplifyPackage amplify provides the client and types for making API requests to AWS Amplify.
amplify/amplifyifacePackage amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
apigatewayPackage apigateway provides the client and types for making API requests to Amazon API Gateway.
apigateway/apigatewayifacePackage apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
apigatewaymanagementapiPackage apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
apigatewaymanagementapi/apigatewaymanagementapiifacePackage apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
apigatewayv2Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
apigatewayv2/apigatewayv2ifacePackage apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
applicationautoscalingPackage applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
applicationautoscaling/applicationautoscalingifacePackage applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
applicationdiscoveryservicePackage applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
applicationdiscoveryservice/applicationdiscoveryserviceifacePackage applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
applicationinsightsPackage applicationinsights provides the client and types for making API requests to Amazon CloudWatch Application Insights.
applicationinsights/applicationinsightsifacePackage applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
appmeshPackage appmesh provides the client and types for making API requests to AWS App Mesh.
appmesh/appmeshifacePackage appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
appstreamPackage appstream provides the client and types for making API requests to Amazon AppStream.
appstream/appstreamifacePackage appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
appsyncPackage appsync provides the client and types for making API requests to AWS AppSync.
appsync/appsyncifacePackage appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
athenaPackage athena provides the client and types for making API requests to Amazon Athena.
athena/athenaifacePackage athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
autoscalingPackage autoscaling provides the client and types for making API requests to Auto Scaling.
autoscaling/autoscalingifacePackage autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
autoscalingplansPackage autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
autoscalingplans/autoscalingplansifacePackage autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
backupPackage backup provides the client and types for making API requests to AWS Backup.
backup/backupifacePackage backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
batchPackage batch provides the client and types for making API requests to AWS Batch.
batch/batchifacePackage batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
budgetsPackage budgets provides the client and types for making API requests to AWS Budgets.
budgets/budgetsifacePackage budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
chimePackage chime provides the client and types for making API requests to Amazon Chime.
chime/chimeifacePackage chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
cloud9Package cloud9 provides the client and types for making API requests to AWS Cloud9.
cloud9/cloud9ifacePackage cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
clouddirectoryPackage clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
clouddirectory/clouddirectoryifacePackage clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
cloudformationPackage cloudformation provides the client and types for making API requests to AWS CloudFormation.
cloudformation/cloudformationifacePackage cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
cloudfrontPackage cloudfront provides the client and types for making API requests to Amazon CloudFront.
cloudfront/cloudfrontifacePackage cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
cloudfront/signPackage sign provides utilities to generate signed URLs for Amazon CloudFront.
cloudhsmPackage cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
cloudhsm/cloudhsmifacePackage cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
cloudhsmv2Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
cloudhsmv2/cloudhsmv2ifacePackage cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
cloudsearchPackage cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
cloudsearch/cloudsearchifacePackage cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
cloudsearchdomainPackage cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
cloudsearchdomain/cloudsearchdomainifacePackage cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
cloudtrailPackage cloudtrail provides the client and types for making API requests to AWS CloudTrail.
cloudtrail/cloudtrailifacePackage cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
cloudwatchPackage cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
cloudwatch/cloudwatchifacePackage cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
cloudwatcheventsPackage cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
cloudwatchevents/cloudwatcheventsifacePackage cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
cloudwatchlogsPackage cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
cloudwatchlogs/cloudwatchlogsifacePackage cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
codebuildPackage codebuild provides the client and types for making API requests to AWS CodeBuild.
codebuild/codebuildifacePackage codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
codecommitPackage codecommit provides the client and types for making API requests to AWS CodeCommit.
codecommit/codecommitifacePackage codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
codedeployPackage codedeploy provides the client and types for making API requests to AWS CodeDeploy.
codedeploy/codedeployifacePackage codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
codepipelinePackage codepipeline provides the client and types for making API requests to AWS CodePipeline.
codepipeline/codepipelineifacePackage codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
codestarPackage codestar provides the client and types for making API requests to AWS CodeStar.
codestar/codestarifacePackage codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
codestarnotificationsPackage codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
codestarnotifications/codestarnotificationsifacePackage codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
cognitoidentityPackage cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
cognitoidentity/cognitoidentityifacePackage cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
cognitoidentityproviderPackage cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
cognitoidentityprovider/cognitoidentityproviderifacePackage cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
cognitosyncPackage cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
cognitosync/cognitosyncifacePackage cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
comprehendPackage comprehend provides the client and types for making API requests to Amazon Comprehend.
comprehend/comprehendifacePackage comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
comprehendmedicalPackage comprehendmedical provides the client and types for making API requests to AWS Comprehend Medical.
comprehendmedical/comprehendmedicalifacePackage comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
configservicePackage configservice provides the client and types for making API requests to AWS Config.
configservice/configserviceifacePackage configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
connectPackage connect provides the client and types for making API requests to Amazon Connect Service.
connect/connectifacePackage connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
costandusagereportservicePackage costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
costandusagereportservice/costandusagereportserviceifacePackage costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
costexplorerPackage costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
costexplorer/costexplorerifacePackage costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
databasemigrationservicePackage databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
databasemigrationservice/databasemigrationserviceifacePackage databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
dataexchangePackage dataexchange provides the client and types for making API requests to AWS Data Exchange.
dataexchange/dataexchangeifacePackage dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
datapipelinePackage datapipeline provides the client and types for making API requests to AWS Data Pipeline.
datapipeline/datapipelineifacePackage datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
datasyncPackage datasync provides the client and types for making API requests to AWS DataSync.
datasync/datasyncifacePackage datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
daxPackage dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
dax/daxifacePackage daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
devicefarmPackage devicefarm provides the client and types for making API requests to AWS Device Farm.
devicefarm/devicefarmifacePackage devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
directconnectPackage directconnect provides the client and types for making API requests to AWS Direct Connect.
directconnect/directconnectifacePackage directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
directoryservicePackage directoryservice provides the client and types for making API requests to AWS Directory Service.
directoryservice/directoryserviceifacePackage directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
dlmPackage dlm provides the client and types for making API requests to Amazon Data Lifecycle Manager.
dlm/dlmifacePackage dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
docdbPackage docdb provides the client and types for making API requests to Amazon DocumentDB with MongoDB compatibility.
docdb/docdbifacePackage docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
dynamodbPackage dynamodb provides the client and types for making API requests to Amazon DynamoDB.
dynamodb/dynamodbattributePackage dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
dynamodb/dynamodbifacePackage dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
dynamodb/expressionPackage expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
dynamodbstreamsPackage dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
dynamodbstreams/dynamodbstreamsifacePackage dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
ec2Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
ec2/ec2ifacePackage ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
ec2instanceconnectPackage ec2instanceconnect provides the client and types for making API requests to AWS EC2 Instance Connect.
ec2instanceconnect/ec2instanceconnectifacePackage ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
ecrPackage ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
ecr/ecrifacePackage ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
ecsPackage ecs provides the client and types for making API requests to Amazon EC2 Container Service.
ecs/ecsifacePackage ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
efsPackage efs provides the client and types for making API requests to Amazon Elastic File System.
efs/efsifacePackage efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
eksPackage eks provides the client and types for making API requests to Amazon Elastic Kubernetes Service.
eks/eksifacePackage eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
elasticachePackage elasticache provides the client and types for making API requests to Amazon ElastiCache.
elasticache/elasticacheifacePackage elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
elasticbeanstalkPackage elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
elasticbeanstalk/elasticbeanstalkifacePackage elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
elasticsearchservicePackage elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
elasticsearchservice/elasticsearchserviceifacePackage elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
elastictranscoderPackage elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
elastictranscoder/elastictranscoderifacePackage elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
elbPackage elb provides the client and types for making API requests to Elastic Load Balancing.
elb/elbifacePackage elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
elbv2Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
elbv2/elbv2ifacePackage elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
emrPackage emr provides the client and types for making API requests to Amazon Elastic MapReduce.
emr/emrifacePackage emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
eventbridgePackage eventbridge provides the client and types for making API requests to Amazon EventBridge.
eventbridge/eventbridgeifacePackage eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
firehosePackage firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
firehose/firehoseifacePackage firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
fmsPackage fms provides the client and types for making API requests to Firewall Management Service.
fms/fmsifacePackage fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
forecastqueryservicePackage forecastqueryservice provides the client and types for making API requests to Amazon Forecast Query Service.
forecastqueryservice/forecastqueryserviceifacePackage forecastqueryserviceiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
forecastservicePackage forecastservice provides the client and types for making API requests to Amazon Forecast Service.
forecastservice/forecastserviceifacePackage forecastserviceiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
fsxPackage fsx provides the client and types for making API requests to Amazon FSx.
fsx/fsxifacePackage fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
gameliftPackage gamelift provides the client and types for making API requests to Amazon GameLift.
gamelift/gameliftifacePackage gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
glacierPackage glacier provides the client and types for making API requests to Amazon Glacier.
glacier/glacierifacePackage glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
globalacceleratorPackage globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
globalaccelerator/globalacceleratorifacePackage globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
gluePackage glue provides the client and types for making API requests to AWS Glue.
glue/glueifacePackage glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
greengrassPackage greengrass provides the client and types for making API requests to AWS Greengrass.
greengrass/greengrassifacePackage greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
groundstationPackage groundstation provides the client and types for making API requests to AWS Ground Station.
groundstation/groundstationifacePackage groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
guarddutyPackage guardduty provides the client and types for making API requests to Amazon GuardDuty.
guardduty/guarddutyifacePackage guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
healthPackage health provides the client and types for making API requests to AWS Health APIs and Notifications.
health/healthifacePackage healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
iamPackage iam provides the client and types for making API requests to AWS Identity and Access Management.
iam/iamifacePackage iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
inspectorPackage inspector provides the client and types for making API requests to Amazon Inspector.
inspector/inspectorifacePackage inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
iotPackage iot provides the client and types for making API requests to AWS IoT.
iot1clickdevicesservicePackage iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
iot1clickdevicesservice/iot1clickdevicesserviceifacePackage iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
iot1clickprojectsPackage iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
iot1clickprojects/iot1clickprojectsifacePackage iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
iotanalyticsPackage iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
iotanalytics/iotanalyticsifacePackage iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
iotdataplanePackage iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
iotdataplane/iotdataplaneifacePackage iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
ioteventsPackage iotevents provides the client and types for making API requests to AWS IoT Events.
ioteventsdataPackage ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
ioteventsdata/ioteventsdataifacePackage ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
iotevents/ioteventsifacePackage ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
iot/iotifacePackage iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
iotjobsdataplanePackage iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
iotjobsdataplane/iotjobsdataplaneifacePackage iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
iotthingsgraphPackage iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
iotthingsgraph/iotthingsgraphifacePackage iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
kafkaPackage kafka provides the client and types for making API requests to Managed Streaming for Kafka.
kafka/kafkaifacePackage kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
kinesisPackage kinesis provides the client and types for making API requests to Amazon Kinesis.
kinesisanalyticsPackage kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
kinesisanalytics/kinesisanalyticsifacePackage kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kinesisanalyticsv2Package kinesisanalyticsv2 provides the client and types for making API requests to Amazon Kinesis Analytics.
kinesisanalyticsv2/kinesisanalyticsv2ifacePackage kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kinesis/kinesisifacePackage kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
kinesisvideoPackage kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
kinesisvideoarchivedmediaPackage kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
kinesisvideoarchivedmedia/kinesisvideoarchivedmediaifacePackage kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
kinesisvideo/kinesisvideoifacePackage kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
kinesisvideomediaPackage kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
kinesisvideomedia/kinesisvideomediaifacePackage kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
kmsPackage kms provides the client and types for making API requests to AWS Key Management Service.
kms/kmsifacePackage kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
lakeformationPackage lakeformation provides the client and types for making API requests to AWS Lake Formation.
lakeformation/lakeformationifacePackage lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
lambdaPackage lambda provides the client and types for making API requests to AWS Lambda.
lambda/lambdaifacePackage lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
lexmodelbuildingservicePackage lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
lexmodelbuildingservice/lexmodelbuildingserviceifacePackage lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
lexruntimeservicePackage lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
lexruntimeservice/lexruntimeserviceifacePackage lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
licensemanagerPackage licensemanager provides the client and types for making API requests to AWS License Manager.
licensemanager/licensemanagerifacePackage licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
lightsailPackage lightsail provides the client and types for making API requests to Amazon Lightsail.
lightsail/lightsailifacePackage lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
machinelearningPackage machinelearning provides the client and types for making API requests to Amazon Machine Learning.
machinelearning/machinelearningifacePackage machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
maciePackage macie provides the client and types for making API requests to Amazon Macie.
macie/macieifacePackage macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
managedblockchainPackage managedblockchain provides the client and types for making API requests to Amazon Managed Blockchain.
managedblockchain/managedblockchainifacePackage managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
marketplacecatalogPackage marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog Service.
marketplacecatalog/marketplacecatalogifacePackage marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
marketplacecommerceanalyticsPackage marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
marketplacecommerceanalytics/marketplacecommerceanalyticsifacePackage marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
marketplaceentitlementservicePackage marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
marketplaceentitlementservice/marketplaceentitlementserviceifacePackage marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
marketplacemeteringPackage marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
marketplacemetering/marketplacemeteringifacePackage marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
mediaconnectPackage mediaconnect provides the client and types for making API requests to AWS MediaConnect.
mediaconnect/mediaconnectifacePackage mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
mediaconvertPackage mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
mediaconvert/mediaconvertifacePackage mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
medialivePackage medialive provides the client and types for making API requests to AWS Elemental MediaLive.
medialive/medialiveifacePackage medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
mediapackagePackage mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
mediapackage/mediapackageifacePackage mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
mediapackagevodPackage mediapackagevod provides the client and types for making API requests to AWS Elemental MediaPackage VOD.
mediapackagevod/mediapackagevodifacePackage mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
mediastorePackage mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
mediastoredataPackage mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
mediastoredata/mediastoredataifacePackage mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
mediastore/mediastoreifacePackage mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
mediatailorPackage mediatailor provides the client and types for making API requests to AWS MediaTailor.
mediatailor/mediatailorifacePackage mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
migrationhubPackage migrationhub provides the client and types for making API requests to AWS Migration Hub.
migrationhub/migrationhubifacePackage migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
mobilePackage mobile provides the client and types for making API requests to AWS Mobile.
mobileanalyticsPackage mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
mobileanalytics/mobileanalyticsifacePackage mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
mobile/mobileifacePackage mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
mqPackage mq provides the client and types for making API requests to AmazonMQ.
mq/mqifacePackage mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
mturkPackage mturk provides the client and types for making API requests to Amazon Mechanical Turk.
mturk/mturkifacePackage mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
neptunePackage neptune provides the client and types for making API requests to Amazon Neptune.
neptune/neptuneifacePackage neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
opsworksPackage opsworks provides the client and types for making API requests to AWS OpsWorks.
opsworkscmPackage opsworkscm provides the client and types for making API requests to AWS OpsWorks CM.
opsworkscm/opsworkscmifacePackage opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
opsworks/opsworksifacePackage opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
organizationsPackage organizations provides the client and types for making API requests to AWS Organizations.
organizations/organizationsifacePackage organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
personalizePackage personalize provides the client and types for making API requests to Amazon Personalize.
personalizeeventsPackage personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
personalizeevents/personalizeeventsifacePackage personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
personalize/personalizeifacePackage personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
personalizeruntimePackage personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
personalizeruntime/personalizeruntimeifacePackage personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
piPackage pi provides the client and types for making API requests to AWS Performance Insights.
pinpointPackage pinpoint provides the client and types for making API requests to Amazon Pinpoint.
pinpointemailPackage pinpointemail provides the client and types for making API requests to Amazon Pinpoint Email Service.
pinpointemail/pinpointemailifacePackage pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
pinpoint/pinpointifacePackage pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
pinpointsmsvoicePackage pinpointsmsvoice provides the client and types for making API requests to Amazon Pinpoint SMS and Voice Service.
pinpointsmsvoice/pinpointsmsvoiceifacePackage pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
pi/piifacePackage piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
pollyPackage polly provides the client and types for making API requests to Amazon Polly.
polly/pollyifacePackage pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
pricingPackage pricing provides the client and types for making API requests to AWS Price List Service.
pricing/pricingifacePackage pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
qldbPackage qldb provides the client and types for making API requests to Amazon QLDB.
qldb/qldbifacePackage qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
qldbsessionPackage qldbsession provides the client and types for making API requests to Amazon QLDB Session.
qldbsession/qldbsessionifacePackage qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
quicksightPackage quicksight provides the client and types for making API requests to Amazon QuickSight.
quicksight/quicksightifacePackage quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
ramPackage ram provides the client and types for making API requests to AWS Resource Access Manager.
ram/ramifacePackage ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
rdsPackage rds provides the client and types for making API requests to Amazon Relational Database Service.
rdsdataservicePackage rdsdataservice provides the client and types for making API requests to AWS RDS DataService.
rdsdataservice/rdsdataserviceifacePackage rdsdataserviceiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
rds/rdsifacePackage rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
rds/rdsutilsPackage rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
redshiftPackage redshift provides the client and types for making API requests to Amazon Redshift.
redshift/redshiftifacePackage redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
rekognitionPackage rekognition provides the client and types for making API requests to Amazon Rekognition.
rekognition/rekognitionifacePackage rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
resourcegroupsPackage resourcegroups provides the client and types for making API requests to AWS Resource Groups.
resourcegroups/resourcegroupsifacePackage resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
resourcegroupstaggingapiPackage resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
resourcegroupstaggingapi/resourcegroupstaggingapiifacePackage resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
robomakerPackage robomaker provides the client and types for making API requests to AWS RoboMaker.
robomaker/robomakerifacePackage robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
route53Package route53 provides the client and types for making API requests to Amazon Route 53.
route53domainsPackage route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
route53domains/route53domainsifacePackage route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
route53resolverPackage route53resolver provides the client and types for making API requests to Amazon Route 53 Resolver.
route53resolver/route53resolverifacePackage route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
route53/route53ifacePackage route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
s3Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
s3controlPackage s3control provides the client and types for making API requests to AWS S3 Control.
s3control/s3controlifacePackage s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
s3/s3cryptoPackage s3crypto provides encryption to S3 using KMS and AES GCM.
s3/s3ifacePackage s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
s3/s3managerPackage s3manager provides utilities to upload and download objects from S3 concurrently.
s3/s3manager/s3managerifacePackage s3manageriface provides an interface for the s3manager package
sagemakerPackage sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
sagemakerruntimePackage sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
sagemakerruntime/sagemakerruntimeifacePackage sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
sagemaker/sagemakerifacePackage sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
savingsplansPackage savingsplans provides the client and types for making API requests to AWS Savings Plans.
savingsplans/savingsplansifacePackage savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
secretsmanagerPackage secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
secretsmanager/secretsmanagerifacePackage secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
securityhubPackage securityhub provides the client and types for making API requests to AWS SecurityHub.
securityhub/securityhubifacePackage securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
serverlessapplicationrepositoryPackage serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
serverlessapplicationrepository/serverlessapplicationrepositoryifacePackage serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
servicecatalogPackage servicecatalog provides the client and types for making API requests to AWS Service Catalog.
servicecatalog/servicecatalogifacePackage servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
servicediscoveryPackage servicediscovery provides the client and types for making API requests to AWS Cloud Map.
servicediscovery/servicediscoveryifacePackage servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
servicequotasPackage servicequotas provides the client and types for making API requests to Service Quotas.
servicequotas/servicequotasifacePackage servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
sesPackage ses provides the client and types for making API requests to Amazon Simple Email Service.
ses/sesifacePackage sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sesv2Package sesv2 provides the client and types for making API requests to Amazon Simple Email Service.
sesv2/sesv2ifacePackage sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sfnPackage sfn provides the client and types for making API requests to AWS Step Functions.
sfn/sfnifacePackage sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
shieldPackage shield provides the client and types for making API requests to AWS Shield.
shield/shieldifacePackage shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
signerPackage signer provides the client and types for making API requests to AWS Signer.
signer/signerifacePackage signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
simpledbPackage simpledb provides the client and types for making API requests to Amazon SimpleDB.
simpledb/simpledbifacePackage simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
smsPackage sms provides the client and types for making API requests to AWS Server Migration Service.
sms/smsifacePackage smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
snowballPackage snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
snowball/snowballifacePackage snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
snsPackage sns provides the client and types for making API requests to Amazon Simple Notification Service.
sns/snsifacePackage snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
sqsPackage sqs provides the client and types for making API requests to Amazon Simple Queue Service.
sqs/sqsifacePackage sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
ssmPackage ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
ssm/ssmifacePackage ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
ssoPackage sso provides the client and types for making API requests to AWS Single Sign-On.
ssooidcPackage ssooidc provides the client and types for making API requests to AWS SSO OIDC.
ssooidc/ssooidcifacePackage ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
sso/ssoifacePackage ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
storagegatewayPackage storagegateway provides the client and types for making API requests to AWS Storage Gateway.
storagegateway/storagegatewayifacePackage storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
stsPackage sts provides the client and types for making API requests to AWS Security Token Service.
sts/stsifacePackage stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
supportPackage support provides the client and types for making API requests to AWS Support.
support/supportifacePackage supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
swfPackage swf provides the client and types for making API requests to Amazon Simple Workflow Service.
swf/swfifacePackage swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
textractPackage textract provides the client and types for making API requests to Amazon Textract.
textract/textractifacePackage textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
transcribeservicePackage transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
transcribeservice/transcribeserviceifacePackage transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
transferPackage transfer provides the client and types for making API requests to AWS Transfer for SFTP.
transfer/transferifacePackage transferiface provides an interface to enable mocking the AWS Transfer for SFTP service client for testing your code.
translatePackage translate provides the client and types for making API requests to Amazon Translate.
translate/translateifacePackage translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
wafPackage waf provides the client and types for making API requests to AWS WAF.
wafregionalPackage wafregional provides the client and types for making API requests to AWS WAF Regional.
wafregional/wafregionalifacePackage wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
waf/wafifacePackage wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
workdocsPackage workdocs provides the client and types for making API requests to Amazon WorkDocs.
workdocs/workdocsifacePackage workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
worklinkPackage worklink provides the client and types for making API requests to Amazon WorkLink.
worklink/worklinkifacePackage worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
workmailPackage workmail provides the client and types for making API requests to Amazon WorkMail.
workmailmessageflowPackage workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
workmailmessageflow/workmailmessageflowifacePackage workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
workmail/workmailifacePackage workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
workspacesPackage workspaces provides the client and types for making API requests to Amazon WorkSpaces.
workspaces/workspacesifacePackage workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
xrayPackage xray provides the client and types for making API requests to AWS X-Ray.
xray/xrayifacePackage xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.

Updated 2019-11-16. Refresh now. Tools for package owners.