aws-sdk-go: Index | Files | Directories

package sdk

import ""

Package sdk is the official AWS SDK for the Go programming language.

The AWS SDK for Go provides APIs and utilities that developers can use to build Go applications that use AWS services, such as Amazon Elastic Compute Cloud (Amazon EC2) and Amazon Simple Storage Service (Amazon S3).

The SDK removes the complexity of coding directly against a web service interface. It hides a lot of the lower-level plumbing, such as authentication, request retries, and error handling.

The SDK also includes helpful utilities on top of the AWS APIs that add additional capabilities and functionality. For example, the Amazon S3 Download and Upload Manager will automatically split up large objects into multiple parts and transfer them concurrently.

See the s3manager package documentation for more information.

Getting More Information

Checkout the Getting Started Guide and API Reference Docs detailed the SDK's components and details on each AWS client the SDK supports.

The Getting Started Guide provides examples and detailed description of how to get setup with the SDK.

The API Reference Docs include a detailed breakdown of the SDK's components such as utilities and AWS clients. Use this as a reference of the Go types included with the SDK, such as AWS clients, API operations, and API parameters.

Overview of SDK's Packages

The SDK is composed of two main components, SDK core, and service clients. The SDK core packages are all available under the aws package at the root of the SDK. Each client for a supported AWS service is available within its own package under the service folder at the root of the SDK.

* aws - SDK core, provides common shared types such as Config, Logger,
  and utilities to make working with API parameters easier.

    * awserr - Provides the error interface that the SDK will use for all
      errors that occur in the SDK's processing. This includes service API
      response errors as well. The Error type is made up of a code and message.
      Cast the SDK's returned error type to awserr.Error and call the Code
      method to compare returned error to specific error codes. See the package's
      documentation for additional values that can be extracted such as RequestId.

    * credentials - Provides the types and built in credentials providers
      the SDK will use to retrieve AWS credentials to make API requests with.
      Nested under this folder are also additional credentials providers such as
      stscreds for assuming IAM roles, and ec2rolecreds for EC2 Instance roles.

    * endpoints - Provides the AWS Regions and Endpoints metadata for the SDK.
      Use this to lookup AWS service endpoint information such as which services
      are in a region, and what regions a service is in. Constants are also provided
      for all region identifiers, e.g UsWest2RegionID for "us-west-2".

    * session - Provides initial default configuration, and load
      configuration from external sources such as environment and shared
      credentials file.

    * request - Provides the API request sending, and retry logic for the SDK.
      This package also includes utilities for defining your own request
      retryer, and configuring how the SDK processes the request.

* service - Clients for AWS services. All services supported by the SDK are
  available under this folder.

How to Use the SDK's AWS Service Clients

The SDK includes the Go types and utilities you can use to make requests to AWS service APIs. Within the service folder at the root of the SDK you'll find a package for each AWS service the SDK supports. All service clients follows a common pattern of creation and usage.

When creating a client for an AWS service you'll first need to have a Session value constructed. The Session provides shared configuration that can be shared between your service clients. When service clients are created you can pass in additional configuration via the aws.Config type to override configuration provided by in the Session to create service client instances with custom configuration.

Once the service's client is created you can use it to make API requests the AWS service. These clients are safe to use concurrently.

Configuring the SDK

In the AWS SDK for Go, you can configure settings for service clients, such as the log level and maximum number of retries. Most settings are optional; however, for each service client, you must specify a region and your credentials. The SDK uses these values to send requests to the correct AWS region and sign requests with the correct credentials. You can specify these values as part of a session or as environment variables.

See the SDK's configuration guide for more information.

See the session package documentation for more information on how to use Session with the SDK.

See the Config type in the aws package for more information on configuration options.

Configuring Credentials

When using the SDK you'll generally need your AWS credentials to authenticate with AWS services. The SDK supports multiple methods of supporting these credentials. By default the SDK will source credentials automatically from its default credential chain. See the session package for more information on this chain, and how to configure it. The common items in the credential chain are the following:

* Environment Credentials - Set of environment variables that are useful
  when sub processes are created for specific roles.

* Shared Credentials file (~/.aws/credentials) - This file stores your
  credentials based on a profile name and is useful for local development.

* EC2 Instance Role Credentials - Use EC2 Instance Role to assign credentials
  to application running on an EC2 instance. This removes the need to manage
  credential files in production.

Credentials can be configured in code as well by setting the Config's Credentials value to a custom provider or using one of the providers included with the SDK to bypass the default credential chain and use a custom one. This is helpful when you want to instruct the SDK to only use a specific set of credentials or providers.

This example creates a credential provider for assuming an IAM role, "myRoleARN" and configures the S3 service client to use that role for API requests.

// Initial credentials loaded from SDK's default credential chain. Such as
// the environment, shared credentials (~/.aws/credentials), or EC2 Instance
// Role. These credentials will be used to to make the STS Assume Role API.
sess := session.Must(session.NewSession())

// Create the credentials from AssumeRoleProvider to assume the role
// referenced by the "myRoleARN" ARN.
creds := stscreds.NewCredentials(sess, "myRoleArn")

// Create service client value configured for credentials
// from assumed role.
svc := s3.New(sess, &aws.Config{Credentials: creds})/

See the credentials package documentation for more information on credential providers included with the SDK, and how to customize the SDK's usage of credentials.

The SDK has support for the shared configuration file (~/.aws/config). This support can be enabled by setting the environment variable, "AWS_SDK_LOAD_CONFIG=1", or enabling the feature in code when creating a Session via the Option's SharedConfigState parameter.

sess := session.Must(session.NewSessionWithOptions(session.Options{
    SharedConfigState: session.SharedConfigEnable,

Configuring AWS Region

In addition to the credentials you'll need to specify the region the SDK will use to make AWS API requests to. In the SDK you can specify the region either with an environment variable, or directly in code when a Session or service client is created. The last value specified in code wins if the region is specified multiple ways.

To set the region via the environment variable set the "AWS_REGION" to the region you want to the SDK to use. Using this method to set the region will allow you to run your application in multiple regions without needing additional code in the application to select the region.


The endpoints package includes constants for all regions the SDK knows. The values are all suffixed with RegionID. These values are helpful, because they reduce the need to type the region string manually.

To set the region on a Session use the aws package's Config struct parameter Region to the AWS region you want the service clients created from the session to use. This is helpful when you want to create multiple service clients, and all of the clients make API requests to the same region.

sess := session.Must(session.NewSession(&aws.Config{
    Region: aws.String(endpoints.UsWest2RegionID),

See the endpoints package for the AWS Regions and Endpoints metadata.

In addition to setting the region when creating a Session you can also set the region on a per service client bases. This overrides the region of a Session. This is helpful when you want to create service clients in specific regions different from the Session's region.

svc := s3.New(sess, &aws.Config{
    Region: aws.String(endpoints.UsWest2RegionID),

See the Config type in the aws package for more information and additional options such as setting the Endpoint, and other service client configuration options.

Making API Requests

Once the client is created you can make an API request to the service. Each API method takes a input parameter, and returns the service response and an error. The SDK provides methods for making the API call in multiple ways.

In this list we'll use the S3 ListObjects API as an example for the different ways of making API requests.

* ListObjects - Base API operation that will make the API request to the service.

* ListObjectsRequest - API methods suffixed with Request will construct the
  API request, but not send it. This is also helpful when you want to get a
  presigned URL for a request, and share the presigned URL instead of your
  application making the request directly.

* ListObjectsPages - Same as the base API operation, but uses a callback to
  automatically handle pagination of the API's response.

* ListObjectsWithContext - Same as base API operation, but adds support for
  the Context pattern. This is helpful for controlling the canceling of in
  flight requests. See the Go standard library context package for more
  information. This method also takes request package's Option functional
  options as the variadic argument for modifying how the request will be
  made, or extracting information from the raw HTTP response.

* ListObjectsPagesWithContext - same as ListObjectsPages, but adds support for
  the Context pattern. Similar to ListObjectsWithContext this method also
  takes the request package's Option function option types as the variadic

In addition to the API operations the SDK also includes several higher level methods that abstract checking for and waiting for an AWS resource to be in a desired state. In this list we'll use WaitUntilBucketExists to demonstrate the different forms of waiters.

* WaitUntilBucketExists. - Method to make API request to query an AWS service for
  a resource's state. Will return successfully when that state is accomplished.

* WaitUntilBucketExistsWithContext - Same as WaitUntilBucketExists, but adds
  support for the Context pattern. In addition these methods take request
  package's WaiterOptions to configure the waiter, and how underlying request
  will be made by the SDK.

The API method will document which error codes the service might return for the operation. These errors will also be available as const strings prefixed with "ErrCode" in the service client's package. If there are no errors listed in the API's SDK documentation you'll need to consult the AWS service's API documentation for the errors that could be returned.

ctx := context.Background()

result, err := svc.GetObjectWithContext(ctx, &s3.GetObjectInput{
    Bucket: aws.String("my-bucket"),
    Key: aws.String("my-key"),
if err != nil {
    // Cast err to awserr.Error to handle specific error codes.
    aerr, ok := err.(awserr.Error)
    if ok && aerr.Code() == s3.ErrCodeNoSuchKey {
        // Specific error code handling
    return err

// Make sure to close the body when done with it for S3 GetObject APIs or
// will leak connections.
defer result.Body.Close()

fmt.Println("Object Size:", aws.StringValue(result.ContentLength))

API Request Pagination and Resource Waiters

Pagination helper methods are suffixed with "Pages", and provide the functionality needed to round trip API page requests. Pagination methods take a callback function that will be called for each page of the API's response.

objects := []string{}
err := svc.ListObjectsPagesWithContext(ctx, &s3.ListObjectsInput{
    Bucket: aws.String(myBucket),
}, func(p *s3.ListObjectsOutput, lastPage bool) bool {
    for _, o := range p.Contents {
        objects = append(objects, aws.StringValue(o.Key))
    return true // continue paging
if err != nil {
    panic(fmt.Sprintf("failed to list objects for bucket, %s, %v", myBucket, err))

fmt.Println("Objects in bucket:", objects)

Waiter helper methods provide the functionality to wait for an AWS resource state. These methods abstract the logic needed to to check the state of an AWS resource, and wait until that resource is in a desired state. The waiter will block until the resource is in the state that is desired, an error occurs, or the waiter times out. If a resource times out the error code returned will be request.WaiterResourceNotReadyErrorCode.

err := svc.WaitUntilBucketExistsWithContext(ctx, &s3.HeadBucketInput{
    Bucket: aws.String(myBucket),
if err != nil {
    aerr, ok := err.(awserr.Error)
    if ok && aerr.Code() == request.WaiterResourceNotReadyErrorCode {
        fmt.Fprintf(os.Stderr, "timed out while waiting for bucket to exist")
    panic(fmt.Errorf("failed to wait for bucket to exist, %v", err))
fmt.Println("Bucket", myBucket, "exists")

Complete SDK Example

This example shows a complete working Go file which will upload a file to S3 and use the Context pattern to implement timeout logic that will cancel the request if it takes too long. This example highlights how to use sessions, create a service client, make a request, handle the error, and process the response.

 package main

 import (


 // Uploads a file to S3 given a bucket and object key. Also takes a duration
 // value to terminate the update if it doesn't complete within that time.
 // The AWS Region needs to be provided in the AWS shared config or on the
 // environment variable as `AWS_REGION`. Credentials also must be provided
 // Will default to shared config file, but can load from environment if provided.
 // Usage:
 //   # Upload myfile.txt to myBucket/myKey. Must complete within 10 minutes or will fail
 //   go run withContext.go -b mybucket -k myKey -d 10m < myfile.txt
 func main() {
 	var bucket, key string
 	var timeout time.Duration

 	flag.StringVar(&bucket, "b", "", "Bucket name.")
 	flag.StringVar(&key, "k", "", "Object key name.")
 	flag.DurationVar(&timeout, "d", 0, "Upload timeout.")

 	// All clients require a Session. The Session provides the client with
	// shared configuration such as region, endpoint, and credentials. A
	// Session should be shared where possible to take advantage of
	// configuration and credential caching. See the session package for
	// more information.
 	sess := session.Must(session.NewSession())

	// Create a new instance of the service's client with a Session.
	// Optional aws.Config values can also be provided as variadic arguments
	// to the New function. This option allows you to provide service
	// specific configuration.
 	svc := s3.New(sess)

 	// Create a context with a timeout that will abort the upload if it takes
 	// more than the passed in timeout.
 	ctx := context.Background()
 	var cancelFn func()
 	if timeout > 0 {
 		ctx, cancelFn = context.WithTimeout(ctx, timeout)
 	// Ensure the context is canceled to prevent leaking.
 	// See context package for more information,
 	defer cancelFn()

 	// Uploads the object to S3. The Context will interrupt the request if the
 	// timeout expires.
 	_, err := svc.PutObjectWithContext(ctx, &s3.PutObjectInput{
 		Bucket: aws.String(bucket),
 		Key:    aws.String(key),
 		Body:   os.Stdin,
 	if err != nil {
 		if aerr, ok := err.(awserr.Error); ok && aerr.Code() == request.CanceledErrorCode {
 			// If the SDK can determine the request or retry delay was canceled
 			// by a context the CanceledErrorCode error code will be returned.
 			fmt.Fprintf(os.Stderr, "upload canceled due to timeout, %v\n", err)
 		} else {
 			fmt.Fprintf(os.Stderr, "failed to upload object, %v\n", err)

 	fmt.Printf("successfully uploaded file to %s/%s\n", bucket, key)


Package Files



awsPackage aws provides the core SDK's utilities and shared types.
aws/arnPackage arn provides a parser for interacting with Amazon Resource Names.
aws/awserrPackage awserr represents API error interface accessors for the SDK.
aws/credentialsPackage credentials provides credential retrieval and management
aws/credentials/endpointcredsPackage endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint.
aws/credentials/plugincredsPackage plugincreds implements a credentials provider sourced from a Go plugin.
aws/credentials/processcredsPackage processcreds is a credential Provider to retrieve `credential_process` credentials.
aws/credentials/stscredsPackage stscreds are credential Providers to retrieve STS AWS credentials.
aws/csmPackage csm provides the Client Side Monitoring (CSM) client which enables sending metrics via UDP connection to the CSM agent.
aws/defaultsPackage defaults is a collection of helpers to retrieve the SDK's default configuration and handlers.
aws/ec2metadataPackage ec2metadata provides the client for making API calls to the EC2 Metadata service.
aws/endpointsPackage endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions.
aws/sessionPackage session provides configuration for the SDK's service clients.
aws/signer/v4Package v4 implements signing for AWS V4 signer
awstesting/unitPackage unit performs initialization and validation for unit tests
servicePackage service contains automatically generated AWS clients.
service/accessanalyzerPackage accessanalyzer provides the client and types for making API requests to Access Analyzer.
service/accessanalyzer/accessanalyzerifacePackage accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
service/acmPackage acm provides the client and types for making API requests to AWS Certificate Manager.
service/acm/acmifacePackage acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
service/acmpcaPackage acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
service/acmpca/acmpcaifacePackage acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
service/alexaforbusinessPackage alexaforbusiness provides the client and types for making API requests to Alexa For Business.
service/alexaforbusiness/alexaforbusinessifacePackage alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
service/amplifyPackage amplify provides the client and types for making API requests to AWS Amplify.
service/amplify/amplifyifacePackage amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
service/apigatewayPackage apigateway provides the client and types for making API requests to Amazon API Gateway.
service/apigateway/apigatewayifacePackage apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
service/apigatewaymanagementapiPackage apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
service/apigatewaymanagementapi/apigatewaymanagementapiifacePackage apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
service/apigatewayv2Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2.
service/apigatewayv2/apigatewayv2ifacePackage apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
service/appconfigPackage appconfig provides the client and types for making API requests to Amazon AppConfig.
service/appconfig/appconfigifacePackage appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
service/applicationautoscalingPackage applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
service/applicationautoscaling/applicationautoscalingifacePackage applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
service/applicationdiscoveryservicePackage applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
service/applicationdiscoveryservice/applicationdiscoveryserviceifacePackage applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
service/applicationinsightsPackage applicationinsights provides the client and types for making API requests to Amazon CloudWatch Application Insights.
service/applicationinsights/applicationinsightsifacePackage applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
service/appmeshPackage appmesh provides the client and types for making API requests to AWS App Mesh.
service/appmesh/appmeshifacePackage appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
service/appstreamPackage appstream provides the client and types for making API requests to Amazon AppStream.
service/appstream/appstreamifacePackage appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
service/appsyncPackage appsync provides the client and types for making API requests to AWS AppSync.
service/appsync/appsyncifacePackage appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
service/athenaPackage athena provides the client and types for making API requests to Amazon Athena.
service/athena/athenaifacePackage athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
service/augmentedairuntimePackage augmentedairuntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
service/augmentedairuntime/augmentedairuntimeifacePackage augmentedairuntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
service/autoscalingPackage autoscaling provides the client and types for making API requests to Auto Scaling.
service/autoscaling/autoscalingifacePackage autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
service/autoscalingplansPackage autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
service/autoscalingplans/autoscalingplansifacePackage autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
service/backupPackage backup provides the client and types for making API requests to AWS Backup.
service/backup/backupifacePackage backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
service/batchPackage batch provides the client and types for making API requests to AWS Batch.
service/batch/batchifacePackage batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
service/budgetsPackage budgets provides the client and types for making API requests to AWS Budgets.
service/budgets/budgetsifacePackage budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
service/chimePackage chime provides the client and types for making API requests to Amazon Chime.
service/chime/chimeifacePackage chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
service/cloud9Package cloud9 provides the client and types for making API requests to AWS Cloud9.
service/cloud9/cloud9ifacePackage cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
service/clouddirectoryPackage clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
service/clouddirectory/clouddirectoryifacePackage clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
service/cloudformationPackage cloudformation provides the client and types for making API requests to AWS CloudFormation.
service/cloudformation/cloudformationifacePackage cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
service/cloudfrontPackage cloudfront provides the client and types for making API requests to Amazon CloudFront.
service/cloudfront/cloudfrontifacePackage cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
service/cloudfront/signPackage sign provides utilities to generate signed URLs for Amazon CloudFront.
service/cloudhsmPackage cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
service/cloudhsm/cloudhsmifacePackage cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
service/cloudhsmv2Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
service/cloudhsmv2/cloudhsmv2ifacePackage cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
service/cloudsearchPackage cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
service/cloudsearch/cloudsearchifacePackage cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
service/cloudsearchdomainPackage cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
service/cloudsearchdomain/cloudsearchdomainifacePackage cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
service/cloudtrailPackage cloudtrail provides the client and types for making API requests to AWS CloudTrail.
service/cloudtrail/cloudtrailifacePackage cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
service/cloudwatchPackage cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
service/cloudwatch/cloudwatchifacePackage cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
service/cloudwatcheventsPackage cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
service/cloudwatchevents/cloudwatcheventsifacePackage cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
service/cloudwatchlogsPackage cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
service/cloudwatchlogs/cloudwatchlogsifacePackage cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
service/codebuildPackage codebuild provides the client and types for making API requests to AWS CodeBuild.
service/codebuild/codebuildifacePackage codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
service/codecommitPackage codecommit provides the client and types for making API requests to AWS CodeCommit.
service/codecommit/codecommitifacePackage codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
service/codedeployPackage codedeploy provides the client and types for making API requests to AWS CodeDeploy.
service/codedeploy/codedeployifacePackage codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
service/codeguruprofilerPackage codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
service/codeguruprofiler/codeguruprofilerifacePackage codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
service/codegurureviewerPackage codegurureviewer provides the client and types for making API requests to Amazon CodeGuru Reviewer.
service/codegurureviewer/codegurureviewerifacePackage codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
service/codepipelinePackage codepipeline provides the client and types for making API requests to AWS CodePipeline.
service/codepipeline/codepipelineifacePackage codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
service/codestarPackage codestar provides the client and types for making API requests to AWS CodeStar.
service/codestar/codestarifacePackage codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
service/codestarconnectionsPackage codestarconnections provides the client and types for making API requests to AWS CodeStar connections.
service/codestarconnections/codestarconnectionsifacePackage codestarconnectionsiface provides an interface to enable mocking the AWS CodeStar connections service client for testing your code.
service/codestarnotificationsPackage codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
service/codestarnotifications/codestarnotificationsifacePackage codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
service/cognitoidentityPackage cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
service/cognitoidentity/cognitoidentityifacePackage cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
service/cognitoidentityproviderPackage cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
service/cognitoidentityprovider/cognitoidentityproviderifacePackage cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
service/cognitosyncPackage cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
service/cognitosync/cognitosyncifacePackage cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
service/comprehendPackage comprehend provides the client and types for making API requests to Amazon Comprehend.
service/comprehend/comprehendifacePackage comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
service/comprehendmedicalPackage comprehendmedical provides the client and types for making API requests to AWS Comprehend Medical.
service/comprehendmedical/comprehendmedicalifacePackage comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
service/computeoptimizerPackage computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
service/computeoptimizer/computeoptimizerifacePackage computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
service/configservicePackage configservice provides the client and types for making API requests to AWS Config.
service/configservice/configserviceifacePackage configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
service/connectPackage connect provides the client and types for making API requests to Amazon Connect Service.
service/connect/connectifacePackage connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
service/connectparticipantPackage connectparticipant provides the client and types for making API requests to Amazon Connect Participant Service.
service/connectparticipant/connectparticipantifacePackage connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code.
service/costandusagereportservicePackage costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
service/costandusagereportservice/costandusagereportserviceifacePackage costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
service/costexplorerPackage costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
service/costexplorer/costexplorerifacePackage costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
service/databasemigrationservicePackage databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
service/databasemigrationservice/databasemigrationserviceifacePackage databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
service/dataexchangePackage dataexchange provides the client and types for making API requests to AWS Data Exchange.
service/dataexchange/dataexchangeifacePackage dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
service/datapipelinePackage datapipeline provides the client and types for making API requests to AWS Data Pipeline.
service/datapipeline/datapipelineifacePackage datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
service/datasyncPackage datasync provides the client and types for making API requests to AWS DataSync.
service/datasync/datasyncifacePackage datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
service/daxPackage dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
service/dax/daxifacePackage daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
service/detectivePackage detective provides the client and types for making API requests to Amazon Detective.
service/detective/detectiveifacePackage detectiveiface provides an interface to enable mocking the Amazon Detective service client for testing your code.
service/devicefarmPackage devicefarm provides the client and types for making API requests to AWS Device Farm.
service/devicefarm/devicefarmifacePackage devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
service/directconnectPackage directconnect provides the client and types for making API requests to AWS Direct Connect.
service/directconnect/directconnectifacePackage directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
service/directoryservicePackage directoryservice provides the client and types for making API requests to AWS Directory Service.
service/directoryservice/directoryserviceifacePackage directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
service/dlmPackage dlm provides the client and types for making API requests to Amazon Data Lifecycle Manager.
service/dlm/dlmifacePackage dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
service/docdbPackage docdb provides the client and types for making API requests to Amazon DocumentDB with MongoDB compatibility.
service/docdb/docdbifacePackage docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
service/dynamodbPackage dynamodb provides the client and types for making API requests to Amazon DynamoDB.
service/dynamodb/dynamodbattributePackage dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
service/dynamodb/dynamodbifacePackage dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
service/dynamodb/expressionPackage expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
service/dynamodbstreamsPackage dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
service/dynamodbstreams/dynamodbstreamsifacePackage dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
service/ebsPackage ebs provides the client and types for making API requests to Amazon Elastic Block Store.
service/ebs/ebsifacePackage ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
service/ec2Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
service/ec2/ec2ifacePackage ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
service/ec2instanceconnectPackage ec2instanceconnect provides the client and types for making API requests to AWS EC2 Instance Connect.
service/ec2instanceconnect/ec2instanceconnectifacePackage ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
service/ecrPackage ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
service/ecr/ecrifacePackage ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
service/ecsPackage ecs provides the client and types for making API requests to Amazon EC2 Container Service.
service/ecs/ecsifacePackage ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
service/efsPackage efs provides the client and types for making API requests to Amazon Elastic File System.
service/efs/efsifacePackage efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
service/eksPackage eks provides the client and types for making API requests to Amazon Elastic Kubernetes Service.
service/eks/eksifacePackage eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
service/elasticachePackage elasticache provides the client and types for making API requests to Amazon ElastiCache.
service/elasticache/elasticacheifacePackage elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
service/elasticbeanstalkPackage elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
service/elasticbeanstalk/elasticbeanstalkifacePackage elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
service/elasticinferencePackage elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
service/elasticinference/elasticinferenceifacePackage elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
service/elasticsearchservicePackage elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
service/elasticsearchservice/elasticsearchserviceifacePackage elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
service/elastictranscoderPackage elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
service/elastictranscoder/elastictranscoderifacePackage elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
service/elbPackage elb provides the client and types for making API requests to Elastic Load Balancing.
service/elb/elbifacePackage elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
service/elbv2Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
service/elbv2/elbv2ifacePackage elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
service/emrPackage emr provides the client and types for making API requests to Amazon Elastic MapReduce.
service/emr/emrifacePackage emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
service/eventbridgePackage eventbridge provides the client and types for making API requests to Amazon EventBridge.
service/eventbridge/eventbridgeifacePackage eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
service/firehosePackage firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
service/firehose/firehoseifacePackage firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
service/fmsPackage fms provides the client and types for making API requests to Firewall Management Service.
service/fms/fmsifacePackage fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
service/forecastqueryservicePackage forecastqueryservice provides the client and types for making API requests to Amazon Forecast Query Service.
service/forecastqueryservice/forecastqueryserviceifacePackage forecastqueryserviceiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
service/forecastservicePackage forecastservice provides the client and types for making API requests to Amazon Forecast Service.
service/forecastservice/forecastserviceifacePackage forecastserviceiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
service/frauddetectorPackage frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
service/frauddetector/frauddetectorifacePackage frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
service/fsxPackage fsx provides the client and types for making API requests to Amazon FSx.
service/fsx/fsxifacePackage fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
service/gameliftPackage gamelift provides the client and types for making API requests to Amazon GameLift.
service/gamelift/gameliftifacePackage gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
service/glacierPackage glacier provides the client and types for making API requests to Amazon Glacier.
service/glacier/glacierifacePackage glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
service/globalacceleratorPackage globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
service/globalaccelerator/globalacceleratorifacePackage globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
service/gluePackage glue provides the client and types for making API requests to AWS Glue.
service/glue/glueifacePackage glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
service/greengrassPackage greengrass provides the client and types for making API requests to AWS Greengrass.
service/greengrass/greengrassifacePackage greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
service/groundstationPackage groundstation provides the client and types for making API requests to AWS Ground Station.
service/groundstation/groundstationifacePackage groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
service/guarddutyPackage guardduty provides the client and types for making API requests to Amazon GuardDuty.
service/guardduty/guarddutyifacePackage guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
service/healthPackage health provides the client and types for making API requests to AWS Health APIs and Notifications.
service/health/healthifacePackage healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
service/iamPackage iam provides the client and types for making API requests to AWS Identity and Access Management.
service/iam/iamifacePackage iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
service/imagebuilderPackage imagebuilder provides the client and types for making API requests to EC2 Image Builder.
service/imagebuilder/imagebuilderifacePackage imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code.
service/inspectorPackage inspector provides the client and types for making API requests to Amazon Inspector.
service/inspector/inspectorifacePackage inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
service/iotPackage iot provides the client and types for making API requests to AWS IoT.
service/iot1clickdevicesservicePackage iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
service/iot1clickdevicesservice/iot1clickdevicesserviceifacePackage iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
service/iot1clickprojectsPackage iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
service/iot1clickprojects/iot1clickprojectsifacePackage iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
service/iotanalyticsPackage iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
service/iotanalytics/iotanalyticsifacePackage iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
service/iotdataplanePackage iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
service/iotdataplane/iotdataplaneifacePackage iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
service/ioteventsPackage iotevents provides the client and types for making API requests to AWS IoT Events.
service/ioteventsdataPackage ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
service/ioteventsdata/ioteventsdataifacePackage ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
service/iotevents/ioteventsifacePackage ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
service/iot/iotifacePackage iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
service/iotjobsdataplanePackage iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
service/iotjobsdataplane/iotjobsdataplaneifacePackage iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
service/iotsecuretunnelingPackage iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
service/iotsecuretunneling/iotsecuretunnelingifacePackage iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
service/iotthingsgraphPackage iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
service/iotthingsgraph/iotthingsgraphifacePackage iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
service/kafkaPackage kafka provides the client and types for making API requests to Managed Streaming for Kafka.
service/kafka/kafkaifacePackage kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
service/kendraPackage kendra provides the client and types for making API requests to AWSKendraFrontendService.
service/kendra/kendraifacePackage kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
service/kinesisPackage kinesis provides the client and types for making API requests to Amazon Kinesis.
service/kinesisanalyticsPackage kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
service/kinesisanalytics/kinesisanalyticsifacePackage kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
service/kinesisanalyticsv2Package kinesisanalyticsv2 provides the client and types for making API requests to Amazon Kinesis Analytics.
service/kinesisanalyticsv2/kinesisanalyticsv2ifacePackage kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
service/kinesis/kinesisifacePackage kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
service/kinesisvideoPackage kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
service/kinesisvideoarchivedmediaPackage kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
service/kinesisvideoarchivedmedia/kinesisvideoarchivedmediaifacePackage kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
service/kinesisvideo/kinesisvideoifacePackage kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
service/kinesisvideomediaPackage kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
service/kinesisvideomedia/kinesisvideomediaifacePackage kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
service/kinesisvideosignalingchannelsPackage kinesisvideosignalingchannels provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
service/kinesisvideosignalingchannels/kinesisvideosignalingchannelsifacePackage kinesisvideosignalingchannelsiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
service/kmsPackage kms provides the client and types for making API requests to AWS Key Management Service.
service/kms/kmsifacePackage kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
service/lakeformationPackage lakeformation provides the client and types for making API requests to AWS Lake Formation.
service/lakeformation/lakeformationifacePackage lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
service/lambdaPackage lambda provides the client and types for making API requests to AWS Lambda.
service/lambda/lambdaifacePackage lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
service/lexmodelbuildingservicePackage lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
service/lexmodelbuildingservice/lexmodelbuildingserviceifacePackage lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
service/lexruntimeservicePackage lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
service/lexruntimeservice/lexruntimeserviceifacePackage lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
service/licensemanagerPackage licensemanager provides the client and types for making API requests to AWS License Manager.
service/licensemanager/licensemanagerifacePackage licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
service/lightsailPackage lightsail provides the client and types for making API requests to Amazon Lightsail.
service/lightsail/lightsailifacePackage lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
service/machinelearningPackage machinelearning provides the client and types for making API requests to Amazon Machine Learning.
service/machinelearning/machinelearningifacePackage machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
service/maciePackage macie provides the client and types for making API requests to Amazon Macie.
service/macie/macieifacePackage macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
service/managedblockchainPackage managedblockchain provides the client and types for making API requests to Amazon Managed Blockchain.
service/managedblockchain/managedblockchainifacePackage managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
service/marketplacecatalogPackage marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog Service.
service/marketplacecatalog/marketplacecatalogifacePackage marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
service/marketplacecommerceanalyticsPackage marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
service/marketplacecommerceanalytics/marketplacecommerceanalyticsifacePackage marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
service/marketplaceentitlementservicePackage marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
service/marketplaceentitlementservice/marketplaceentitlementserviceifacePackage marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
service/marketplacemeteringPackage marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
service/marketplacemetering/marketplacemeteringifacePackage marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
service/mediaconnectPackage mediaconnect provides the client and types for making API requests to AWS MediaConnect.
service/mediaconnect/mediaconnectifacePackage mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
service/mediaconvertPackage mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
service/mediaconvert/mediaconvertifacePackage mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
service/medialivePackage medialive provides the client and types for making API requests to AWS Elemental MediaLive.
service/medialive/medialiveifacePackage medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
service/mediapackagePackage mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
service/mediapackage/mediapackageifacePackage mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
service/mediapackagevodPackage mediapackagevod provides the client and types for making API requests to AWS Elemental MediaPackage VOD.
service/mediapackagevod/mediapackagevodifacePackage mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
service/mediastorePackage mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
service/mediastoredataPackage mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
service/mediastoredata/mediastoredataifacePackage mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
service/mediastore/mediastoreifacePackage mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
service/mediatailorPackage mediatailor provides the client and types for making API requests to AWS MediaTailor.
service/mediatailor/mediatailorifacePackage mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
service/migrationhubPackage migrationhub provides the client and types for making API requests to AWS Migration Hub.
service/migrationhubconfigPackage migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
service/migrationhubconfig/migrationhubconfigifacePackage migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
service/migrationhub/migrationhubifacePackage migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
service/mobilePackage mobile provides the client and types for making API requests to AWS Mobile.
service/mobileanalyticsPackage mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
service/mobileanalytics/mobileanalyticsifacePackage mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
service/mobile/mobileifacePackage mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
service/mqPackage mq provides the client and types for making API requests to AmazonMQ.
service/mq/mqifacePackage mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
service/mturkPackage mturk provides the client and types for making API requests to Amazon Mechanical Turk.
service/mturk/mturkifacePackage mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
service/neptunePackage neptune provides the client and types for making API requests to Amazon Neptune.
service/neptune/neptuneifacePackage neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
service/networkmanagerPackage networkmanager provides the client and types for making API requests to AWS Network Manager.
service/networkmanager/networkmanagerifacePackage networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
service/opsworksPackage opsworks provides the client and types for making API requests to AWS OpsWorks.
service/opsworkscmPackage opsworkscm provides the client and types for making API requests to AWS OpsWorks CM.
service/opsworkscm/opsworkscmifacePackage opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
service/opsworks/opsworksifacePackage opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
service/organizationsPackage organizations provides the client and types for making API requests to AWS Organizations.
service/organizations/organizationsifacePackage organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
service/outpostsPackage outposts provides the client and types for making API requests to AWS Outposts.
service/outposts/outpostsifacePackage outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code.
service/personalizePackage personalize provides the client and types for making API requests to Amazon Personalize.
service/personalizeeventsPackage personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
service/personalizeevents/personalizeeventsifacePackage personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
service/personalize/personalizeifacePackage personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
service/personalizeruntimePackage personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
service/personalizeruntime/personalizeruntimeifacePackage personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
service/piPackage pi provides the client and types for making API requests to AWS Performance Insights.
service/pinpointPackage pinpoint provides the client and types for making API requests to Amazon Pinpoint.
service/pinpointemailPackage pinpointemail provides the client and types for making API requests to Amazon Pinpoint Email Service.
service/pinpointemail/pinpointemailifacePackage pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
service/pinpoint/pinpointifacePackage pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
service/pinpointsmsvoicePackage pinpointsmsvoice provides the client and types for making API requests to Amazon Pinpoint SMS and Voice Service.
service/pinpointsmsvoice/pinpointsmsvoiceifacePackage pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
service/pi/piifacePackage piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
service/pollyPackage polly provides the client and types for making API requests to Amazon Polly.
service/polly/pollyifacePackage pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
service/pricingPackage pricing provides the client and types for making API requests to AWS Price List Service.
service/pricing/pricingifacePackage pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
service/qldbPackage qldb provides the client and types for making API requests to Amazon QLDB.
service/qldb/qldbifacePackage qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
service/qldbsessionPackage qldbsession provides the client and types for making API requests to Amazon QLDB Session.
service/qldbsession/qldbsessionifacePackage qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
service/quicksightPackage quicksight provides the client and types for making API requests to Amazon QuickSight.
service/quicksight/quicksightifacePackage quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
service/ramPackage ram provides the client and types for making API requests to AWS Resource Access Manager.
service/ram/ramifacePackage ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
service/rdsPackage rds provides the client and types for making API requests to Amazon Relational Database Service.
service/rdsdataservicePackage rdsdataservice provides the client and types for making API requests to AWS RDS DataService.
service/rdsdataservice/rdsdataserviceifacePackage rdsdataserviceiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
service/rds/rdsifacePackage rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
service/rds/rdsutilsPackage rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
service/redshiftPackage redshift provides the client and types for making API requests to Amazon Redshift.
service/redshift/redshiftifacePackage redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
service/rekognitionPackage rekognition provides the client and types for making API requests to Amazon Rekognition.
service/rekognition/rekognitionifacePackage rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
service/resourcegroupsPackage resourcegroups provides the client and types for making API requests to AWS Resource Groups.
service/resourcegroups/resourcegroupsifacePackage resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
service/resourcegroupstaggingapiPackage resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
service/resourcegroupstaggingapi/resourcegroupstaggingapiifacePackage resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
service/robomakerPackage robomaker provides the client and types for making API requests to AWS RoboMaker.
service/robomaker/robomakerifacePackage robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
service/route53Package route53 provides the client and types for making API requests to Amazon Route 53.
service/route53domainsPackage route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
service/route53domains/route53domainsifacePackage route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
service/route53resolverPackage route53resolver provides the client and types for making API requests to Amazon Route 53 Resolver.
service/route53resolver/route53resolverifacePackage route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
service/route53/route53ifacePackage route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
service/s3Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
service/s3controlPackage s3control provides the client and types for making API requests to AWS S3 Control.
service/s3control/s3controlifacePackage s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
service/s3/s3cryptoPackage s3crypto provides encryption to S3 using KMS and AES GCM.
service/s3/s3ifacePackage s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
service/s3/s3managerPackage s3manager provides utilities to upload and download objects from S3 concurrently.
service/s3/s3manager/s3managerifacePackage s3manageriface provides an interface for the s3manager package
service/sagemakerPackage sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
service/sagemakerruntimePackage sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
service/sagemakerruntime/sagemakerruntimeifacePackage sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
service/sagemaker/sagemakerifacePackage sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
service/savingsplansPackage savingsplans provides the client and types for making API requests to AWS Savings Plans.
service/savingsplans/savingsplansifacePackage savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
service/schemasPackage schemas provides the client and types for making API requests to Schemas.
service/schemas/schemasifacePackage schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
service/secretsmanagerPackage secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
service/secretsmanager/secretsmanagerifacePackage secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
service/securityhubPackage securityhub provides the client and types for making API requests to AWS SecurityHub.
service/securityhub/securityhubifacePackage securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
service/serverlessapplicationrepositoryPackage serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
service/serverlessapplicationrepository/serverlessapplicationrepositoryifacePackage serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
service/servicecatalogPackage servicecatalog provides the client and types for making API requests to AWS Service Catalog.
service/servicecatalog/servicecatalogifacePackage servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
service/servicediscoveryPackage servicediscovery provides the client and types for making API requests to AWS Cloud Map.
service/servicediscovery/servicediscoveryifacePackage servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
service/servicequotasPackage servicequotas provides the client and types for making API requests to Service Quotas.
service/servicequotas/servicequotasifacePackage servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
service/sesPackage ses provides the client and types for making API requests to Amazon Simple Email Service.
service/ses/sesifacePackage sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
service/sesv2Package sesv2 provides the client and types for making API requests to Amazon Simple Email Service.
service/sesv2/sesv2ifacePackage sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
service/sfnPackage sfn provides the client and types for making API requests to AWS Step Functions.
service/sfn/sfnifacePackage sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
service/shieldPackage shield provides the client and types for making API requests to AWS Shield.
service/shield/shieldifacePackage shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
service/signerPackage signer provides the client and types for making API requests to AWS Signer.
service/signer/signerifacePackage signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
service/simpledbPackage simpledb provides the client and types for making API requests to Amazon SimpleDB.
service/simpledb/simpledbifacePackage simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
service/smsPackage sms provides the client and types for making API requests to AWS Server Migration Service.
service/sms/smsifacePackage smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
service/snowballPackage snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
service/snowball/snowballifacePackage snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
service/snsPackage sns provides the client and types for making API requests to Amazon Simple Notification Service.
service/sns/snsifacePackage snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
service/sqsPackage sqs provides the client and types for making API requests to Amazon Simple Queue Service.
service/sqs/sqsifacePackage sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
service/ssmPackage ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
service/ssm/ssmifacePackage ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
service/ssoPackage sso provides the client and types for making API requests to AWS Single Sign-On.
service/ssooidcPackage ssooidc provides the client and types for making API requests to AWS SSO OIDC.
service/ssooidc/ssooidcifacePackage ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
service/sso/ssoifacePackage ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
service/storagegatewayPackage storagegateway provides the client and types for making API requests to AWS Storage Gateway.
service/storagegateway/storagegatewayifacePackage storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
service/stsPackage sts provides the client and types for making API requests to AWS Security Token Service.
service/sts/stsifacePackage stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
service/supportPackage support provides the client and types for making API requests to AWS Support.
service/support/supportifacePackage supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
service/swfPackage swf provides the client and types for making API requests to Amazon Simple Workflow Service.
service/swf/swfifacePackage swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
service/textractPackage textract provides the client and types for making API requests to Amazon Textract.
service/textract/textractifacePackage textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
service/transcribeservicePackage transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
service/transcribeservice/transcribeserviceifacePackage transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
service/transcribestreamingservicePackage transcribestreamingservice provides the client and types for making API requests to Amazon Transcribe Streaming Service.
service/transcribestreamingservice/transcribestreamingserviceifacePackage transcribestreamingserviceiface provides an interface to enable mocking the Amazon Transcribe Streaming Service service client for testing your code.
service/transferPackage transfer provides the client and types for making API requests to AWS Transfer for SFTP.
service/transfer/transferifacePackage transferiface provides an interface to enable mocking the AWS Transfer for SFTP service client for testing your code.
service/translatePackage translate provides the client and types for making API requests to Amazon Translate.
service/translate/translateifacePackage translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
service/wafPackage waf provides the client and types for making API requests to AWS WAF.
service/wafregionalPackage wafregional provides the client and types for making API requests to AWS WAF Regional.
service/wafregional/wafregionalifacePackage wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
service/wafv2Package wafv2 provides the client and types for making API requests to AWS WAFV2.
service/wafv2/wafv2ifacePackage wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
service/waf/wafifacePackage wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
service/workdocsPackage workdocs provides the client and types for making API requests to Amazon WorkDocs.
service/workdocs/workdocsifacePackage workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
service/worklinkPackage worklink provides the client and types for making API requests to Amazon WorkLink.
service/worklink/worklinkifacePackage worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
service/workmailPackage workmail provides the client and types for making API requests to Amazon WorkMail.
service/workmailmessageflowPackage workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
service/workmailmessageflow/workmailmessageflowifacePackage workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
service/workmail/workmailifacePackage workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
service/workspacesPackage workspaces provides the client and types for making API requests to Amazon WorkSpaces.
service/workspaces/workspacesifacePackage workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
service/xrayPackage xray provides the client and types for making API requests to AWS X-Ray.
service/xray/xrayifacePackage xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.

Package sdk imports 1 packages (graph). Updated 2020-04-10. Refresh now. Tools for package owners.