aws-sdk-go-v2: github.com/aws/aws-sdk-go-v2/service

Directories

PathSynopsis
accessanalyzerPackage accessanalyzer provides the client and types for making API requests to Access Analyzer.
accessanalyzer/accessanalyzerifacePackage accessanalyzeriface provides an interface to enable mocking the Access Analyzer service client for testing your code.
acm
acm/acmifacePackage acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
acm/internal/endpoints
acmpcaPackage acmpca provides the client and types for making API requests to ACM-PCA.
acmpca/acmpcaifacePackage acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
acm/types
alexaforbusiness
alexaforbusiness/alexaforbusinessifacePackage alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
alexaforbusiness/internal/endpoints
alexaforbusiness/types
amplifyPackage amplify provides the client and types for making API requests to Amplify.
amplify/amplifyifacePackage amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code.
apigateway
apigateway/apigatewayifacePackage apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
apigateway/internal/customizations
apigateway/internal/endpoints
apigatewaymanagementapiPackage apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi.
apigatewaymanagementapi/apigatewaymanagementapiifacePackage apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code.
apigateway/types
apigatewayv2
apigatewayv2/apigatewayv2ifacePackage apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code.
apigatewayv2/internal/endpoints
apigatewayv2/types
appconfigPackage appconfig provides the client and types for making API requests to AppConfig.
appconfig/appconfigifacePackage appconfigiface provides an interface to enable mocking the Amazon AppConfig service client for testing your code.
applicationautoscalingPackage applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
applicationautoscaling/applicationautoscalingifacePackage applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
applicationdiscoveryservicePackage applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
applicationdiscoveryservice/applicationdiscoveryserviceifacePackage applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
applicationinsightsPackage applicationinsights provides the client and types for making API requests to Application Insights.
applicationinsights/applicationinsightsifacePackage applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code.
appmeshPackage appmesh provides the client and types for making API requests to AWS App Mesh.
appmesh/appmeshifacePackage appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code.
appstreamPackage appstream provides the client and types for making API requests to Amazon AppStream.
appstream/appstreamifacePackage appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
appsync
appsync/appsyncifacePackage appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
appsync/internal/endpoints
appsync/types
athena
athena/athenaifacePackage athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
athena/internal/endpoints
athena/types
autoscaling
autoscaling/autoscalingifacePackage autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
autoscaling/internal/endpoints
autoscalingplansPackage autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
autoscalingplans/autoscalingplansifacePackage autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
autoscaling/types
backup
backup/backupifacePackage backupiface provides an interface to enable mocking the AWS Backup service client for testing your code.
backup/internal/endpoints
backup/types
batchPackage batch provides the client and types for making API requests to AWS Batch.
batch/batchifacePackage batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
braket
braket/internal/endpoints
braket/types
budgets
budgets/budgetsifacePackage budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
budgets/internal/endpoints
budgets/types
chime
chime/chimeifacePackage chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code.
chime/internal/endpoints
chime/types
cloud9Package cloud9 provides the client and types for making API requests to AWS Cloud9.
cloud9/cloud9ifacePackage cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
clouddirectoryPackage clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
clouddirectory/clouddirectoryifacePackage clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
cloudformation
cloudformation/cloudformationifacePackage cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
cloudformation/internal/endpoints
cloudformation/types
cloudfront
cloudfront/cloudfrontifacePackage cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
cloudfront/internal/endpoints
cloudfront/signPackage sign provides utilities to generate signed URLs for Amazon CloudFront.
cloudfront/types
cloudhsmPackage cloudhsm provides the client and types for making API requests to CloudHSM.
cloudhsm/cloudhsmifacePackage cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
cloudhsmv2Package cloudhsmv2 provides the client and types for making API requests to CloudHSM V2.
cloudhsmv2/cloudhsmv2ifacePackage cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
cloudsearchPackage cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
cloudsearch/cloudsearchifacePackage cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
cloudsearchdomainPackage cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
cloudsearchdomain/cloudsearchdomainifacePackage cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
cloudtrailPackage cloudtrail provides the client and types for making API requests to CloudTrail.
cloudtrail/cloudtrailifacePackage cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
cloudwatch
cloudwatchevents
cloudwatchevents/cloudwatcheventsifacePackage cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
cloudwatchevents/internal/endpoints
cloudwatchevents/types
cloudwatch/internal/endpoints
cloudwatchlogsPackage cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
cloudwatchlogs/cloudwatchlogsifacePackage cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
cloudwatch/types
codeartifactPackage codeartifact provides the client and types for making API requests to CodeArtifact.
codeartifact/codeartifactifacePackage codeartifactiface provides an interface to enable mocking the CodeArtifact service client for testing your code.
codebuildPackage codebuild provides the client and types for making API requests to AWS CodeBuild.
codebuild/codebuildifacePackage codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
codecommit
codecommit/codecommitifacePackage codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
codecommit/internal/endpoints
codecommit/types
codedeploy
codedeploy/codedeployifacePackage codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
codedeploy/internal/endpoints
codedeploy/types
codeguruprofilerPackage codeguruprofiler provides the client and types for making API requests to Amazon CodeGuru Profiler.
codeguruprofiler/codeguruprofilerifacePackage codeguruprofileriface provides an interface to enable mocking the Amazon CodeGuru Profiler service client for testing your code.
codegurureviewerPackage codegurureviewer provides the client and types for making API requests to CodeGuruReviewer.
codegurureviewer/codegurureviewerifacePackage codegururevieweriface provides an interface to enable mocking the Amazon CodeGuru Reviewer service client for testing your code.
codepipelinePackage codepipeline provides the client and types for making API requests to CodePipeline.
codepipeline/codepipelineifacePackage codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
codestarPackage codestar provides the client and types for making API requests to CodeStar.
codestar/codestarifacePackage codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
codestarconnectionsPackage codestarconnections provides the client and types for making API requests to AWS CodeStar connections.
codestarconnections/codestarconnectionsifacePackage codestarconnectionsiface provides an interface to enable mocking the AWS CodeStar connections service client for testing your code.
codestarnotificationsPackage codestarnotifications provides the client and types for making API requests to AWS CodeStar Notifications.
codestarnotifications/codestarnotificationsifacePackage codestarnotificationsiface provides an interface to enable mocking the AWS CodeStar Notifications service client for testing your code.
cognitoidentityPackage cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
cognitoidentity/cognitoidentityifacePackage cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
cognitoidentityprovider
cognitoidentityprovider/cognitoidentityproviderifacePackage cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
cognitoidentityprovider/internal/endpoints
cognitoidentityprovider/types
cognitosyncPackage cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
cognitosync/cognitosyncifacePackage cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
comprehend
comprehend/comprehendifacePackage comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
comprehend/internal/endpoints
comprehendmedicalPackage comprehendmedical provides the client and types for making API requests to ComprehendMedical.
comprehendmedical/comprehendmedicalifacePackage comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code.
comprehend/types
computeoptimizerPackage computeoptimizer provides the client and types for making API requests to AWS Compute Optimizer.
computeoptimizer/computeoptimizerifacePackage computeoptimizeriface provides an interface to enable mocking the AWS Compute Optimizer service client for testing your code.
configservicePackage configservice provides the client and types for making API requests to Config Service.
configservice/configserviceifacePackage configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
connectPackage connect provides the client and types for making API requests to Amazon Connect.
connect/connectifacePackage connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
connectparticipantPackage connectparticipant provides the client and types for making API requests to Amazon Connect Participant.
connectparticipant/connectparticipantifacePackage connectparticipantiface provides an interface to enable mocking the Amazon Connect Participant Service service client for testing your code.
costandusagereportservicePackage costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
costandusagereportservice/costandusagereportserviceifacePackage costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
costexplorer
costexplorer/costexplorerifacePackage costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
costexplorer/internal/endpoints
costexplorer/types
databasemigrationservice
databasemigrationservice/databasemigrationserviceifacePackage databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
databasemigrationservice/internal/endpoints
databasemigrationservice/types
dataexchangePackage dataexchange provides the client and types for making API requests to AWS Data Exchange.
dataexchange/dataexchangeifacePackage dataexchangeiface provides an interface to enable mocking the AWS Data Exchange service client for testing your code.
datapipelinePackage datapipeline provides the client and types for making API requests to AWS Data Pipeline.
datapipeline/datapipelineifacePackage datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
datasync
datasync/datasyncifacePackage datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code.
datasync/internal/endpoints
datasync/types
daxPackage dax provides the client and types for making API requests to Amazon DAX.
dax/daxifacePackage daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
detectivePackage detective provides the client and types for making API requests to Amazon Detective.
detective/detectiveifacePackage detectiveiface provides an interface to enable mocking the Amazon Detective service client for testing your code.
devicefarm
devicefarm/devicefarmifacePackage devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
devicefarm/internal/endpoints
devicefarm/types
directconnect
directconnect/directconnectifacePackage directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
directconnect/internal/endpoints
directconnect/types
directoryservice
directoryservice/directoryserviceifacePackage directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
directoryservice/internal/endpoints
directoryservice/types
dlmPackage dlm provides the client and types for making API requests to Amazon DLM.
dlm/dlmifacePackage dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code.
docdbPackage docdb provides the client and types for making API requests to Amazon DocDB.
docdb/docdbifacePackage docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code.
dynamodb
dynamodb/internal/customizationsPackage customizations provides customizations for the Amazon DynamoDB API client.
dynamodb/internal/endpoints
dynamodbstreamsPackage dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
dynamodbstreams/dynamodbstreamsifacePackage dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
dynamodb/types
ebsPackage ebs provides the client and types for making API requests to Amazon EBS.
ebs/ebsifacePackage ebsiface provides an interface to enable mocking the Amazon Elastic Block Store service client for testing your code.
ec2
ec2instanceconnectPackage ec2instanceconnect provides the client and types for making API requests to EC2 Instance Connect.
ec2instanceconnect/ec2instanceconnectifacePackage ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code.
ec2/internal/endpoints
ec2/types
ecr
ecr/ecrifacePackage ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
ecr/internal/endpoints
ecr/types
ecs
ecs/ecsifacePackage ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
ecs/internal/endpoints
ecs/types
efs
efs/efsifacePackage efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
efs/internal/endpoints
efs/types
eks
eks/eksifacePackage eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code.
eks/internal/endpoints
eks/types
elasticache
elasticache/elasticacheifacePackage elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
elasticache/internal/endpoints
elasticache/types
elasticbeanstalk
elasticbeanstalk/elasticbeanstalkifacePackage elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
elasticbeanstalk/internal/endpoints
elasticbeanstalk/types
elasticinferencePackage elasticinference provides the client and types for making API requests to Amazon Elastic Inference.
elasticinference/elasticinferenceifacePackage elasticinferenceiface provides an interface to enable mocking the Amazon Elastic Inference service client for testing your code.
elasticloadbalancingPackage elasticloadbalancing provides the client and types for making API requests to Elastic Load Balancing.
elasticloadbalancing/elasticloadbalancingifacePackage elasticloadbalancingiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
elasticloadbalancingv2
elasticloadbalancingv2/elasticloadbalancingv2ifacePackage elasticloadbalancingv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
elasticloadbalancingv2/internal/endpoints
elasticloadbalancingv2/types
elasticsearchservicePackage elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
elasticsearchservice/elasticsearchserviceifacePackage elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
elastictranscoderPackage elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
elastictranscoder/elastictranscoderifacePackage elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
emr
emr/emrifacePackage emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
emr/internal/endpoints
emr/types
eventbridgePackage eventbridge provides the client and types for making API requests to Amazon EventBridge.
eventbridge/eventbridgeifacePackage eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code.
firehose
firehose/firehoseifacePackage firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
firehose/internal/endpoints
firehose/types
fmsPackage fms provides the client and types for making API requests to FMS.
fms/fmsifacePackage fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
forecastPackage forecast provides the client and types for making API requests to Amazon Forecast Service.
forecast/forecastifacePackage forecastiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code.
forecastqueryPackage forecastquery provides the client and types for making API requests to Amazon Forecast Query Service.
forecastquery/forecastqueryifacePackage forecastqueryiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code.
frauddetectorPackage frauddetector provides the client and types for making API requests to Amazon Fraud Detector.
frauddetector/frauddetectorifacePackage frauddetectoriface provides an interface to enable mocking the Amazon Fraud Detector service client for testing your code.
fsxPackage fsx provides the client and types for making API requests to Amazon FSx.
fsx/fsxifacePackage fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code.
gamelift
gamelift/gameliftifacePackage gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
gamelift/internal/endpoints
gamelift/types
glacierPackage glacier provides the client and types for making API requests to Amazon Glacier.
glacier/glacierifacePackage glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
globalacceleratorPackage globalaccelerator provides the client and types for making API requests to AWS Global Accelerator.
globalaccelerator/globalacceleratorifacePackage globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code.
glue
glue/glueifacePackage glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
glue/internal/endpoints
glue/types
greengrass
greengrass/greengrassifacePackage greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
greengrass/internal/endpoints
greengrass/types
groundstationPackage groundstation provides the client and types for making API requests to AWS Ground Station.
groundstation/groundstationifacePackage groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code.
guardduty
guardduty/guarddutyifacePackage guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
guardduty/internal/endpoints
guardduty/types
healthPackage health provides the client and types for making API requests to AWSHealth.
health/healthifacePackage healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
honeycodePackage honeycode provides the client and types for making API requests to Honeycode.
honeycode/honeycodeifacePackage honeycodeiface provides an interface to enable mocking the Amazon Honeycode service client for testing your code.
iam
iam/iamifacePackage iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
iam/internal/endpoints
iam/types
imagebuilder
imagebuilder/imagebuilderifacePackage imagebuilderiface provides an interface to enable mocking the EC2 Image Builder service client for testing your code.
imagebuilder/internal/endpoints
imagebuilder/types
inspectorPackage inspector provides the client and types for making API requests to Amazon Inspector.
inspector/inspectorifacePackage inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
internal/accept-encodingPackage acceptencoding provides customizations associated with Accept Encoding Header.
internal/integrationtest
internal/s3shared
iotPackage iot provides the client and types for making API requests to AWS IoT.
iot1clickdevicesservicePackage iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
iot1clickdevicesservice/iot1clickdevicesserviceifacePackage iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
iot1clickprojectsPackage iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects.
iot1clickprojects/iot1clickprojectsifacePackage iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
iotanalyticsPackage iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
iotanalytics/iotanalyticsifacePackage iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
iotdataplanePackage iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
iotdataplane/iotdataplaneifacePackage iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
ioteventsPackage iotevents provides the client and types for making API requests to AWS IoT Events.
ioteventsdataPackage ioteventsdata provides the client and types for making API requests to AWS IoT Events Data.
ioteventsdata/ioteventsdataifacePackage ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code.
iotevents/ioteventsifacePackage ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code.
iot/iotifacePackage iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
iotjobsdataplanePackage iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
iotjobsdataplane/iotjobsdataplaneifacePackage iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
iotsecuretunnelingPackage iotsecuretunneling provides the client and types for making API requests to AWS IoT Secure Tunneling.
iotsecuretunneling/iotsecuretunnelingifacePackage iotsecuretunnelingiface provides an interface to enable mocking the AWS IoT Secure Tunneling service client for testing your code.
iotsitewise
iotsitewise/internal/endpoints
iotsitewise/iotsitewiseifacePackage iotsitewiseiface provides an interface to enable mocking the AWS IoT SiteWise service client for testing your code.
iotsitewise/types
iotthingsgraphPackage iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph.
iotthingsgraph/iotthingsgraphifacePackage iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code.
ivsPackage ivs provides the client and types for making API requests to Amazon IVS.
ivs/ivsifacePackage ivsiface provides an interface to enable mocking the Amazon Interactive Video Service service client for testing your code.
kafkaPackage kafka provides the client and types for making API requests to Kafka.
kafka/kafkaifacePackage kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code.
kendraPackage kendra provides the client and types for making API requests to kendra.
kendra/kendraifacePackage kendraiface provides an interface to enable mocking the AWSKendraFrontendService service client for testing your code.
kinesisPackage kinesis provides the client and types for making API requests to Kinesis.
kinesisanalyticsPackage kinesisanalytics provides the client and types for making API requests to Kinesis Analytics.
kinesisanalytics/kinesisanalyticsifacePackage kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kinesisanalyticsv2Package kinesisanalyticsv2 provides the client and types for making API requests to Kinesis Analytics V2.
kinesisanalyticsv2/kinesisanalyticsv2ifacePackage kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
kinesis/kinesisifacePackage kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
kinesisvideo
kinesisvideoarchivedmediaPackage kinesisvideoarchivedmedia provides the client and types for making API requests to Kinesis Video Archived Media.
kinesisvideoarchivedmedia/kinesisvideoarchivedmediaifacePackage kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
kinesisvideo/internal/endpoints
kinesisvideo/kinesisvideoifacePackage kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
kinesisvideomediaPackage kinesisvideomedia provides the client and types for making API requests to Kinesis Video Media.
kinesisvideomedia/kinesisvideomediaifacePackage kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
kinesisvideosignalingPackage kinesisvideosignaling provides the client and types for making API requests to Amazon Kinesis Video Signaling Channels.
kinesisvideosignaling/kinesisvideosignalingifacePackage kinesisvideosignalingiface provides an interface to enable mocking the Amazon Kinesis Video Signaling Channels service client for testing your code.
kinesisvideo/types
kms
kms/internal/endpoints
kms/kmsifacePackage kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
kms/types
lakeformationPackage lakeformation provides the client and types for making API requests to AWS Lake Formation.
lakeformation/lakeformationifacePackage lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code.
lambda
lambda/internal/endpoints
lambda/lambdaifacePackage lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
lambda/types
lexmodelbuildingservice
lexmodelbuildingservice/internal/endpoints
lexmodelbuildingservice/lexmodelbuildingserviceifacePackage lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
lexmodelbuildingservice/types
lexruntimeservicePackage lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
lexruntimeservice/lexruntimeserviceifacePackage lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
licensemanagerPackage licensemanager provides the client and types for making API requests to AWS License Manager.
licensemanager/licensemanagerifacePackage licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code.
lightsail
lightsail/internal/endpoints
lightsail/lightsailifacePackage lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
lightsail/types
machinelearningPackage machinelearning provides the client and types for making API requests to Amazon Machine Learning.
machinelearning/machinelearningifacePackage machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
maciePackage macie provides the client and types for making API requests to Amazon Macie.
macie2
macie2/internal/endpoints
macie2/macie2ifacePackage macie2iface provides an interface to enable mocking the Amazon Macie 2 service client for testing your code.
macie2/types
macie/macieifacePackage macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code.
managedblockchainPackage managedblockchain provides the client and types for making API requests to ManagedBlockchain.
managedblockchain/managedblockchainifacePackage managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code.
marketplacecatalogPackage marketplacecatalog provides the client and types for making API requests to AWS Marketplace Catalog.
marketplacecatalog/marketplacecatalogifacePackage marketplacecatalogiface provides an interface to enable mocking the AWS Marketplace Catalog Service service client for testing your code.
marketplacecommerceanalyticsPackage marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
marketplacecommerceanalytics/marketplacecommerceanalyticsifacePackage marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
marketplaceentitlementservicePackage marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
marketplaceentitlementservice/marketplaceentitlementserviceifacePackage marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
marketplacemeteringPackage marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
marketplacemetering/marketplacemeteringifacePackage marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
mediaconnectPackage mediaconnect provides the client and types for making API requests to AWS MediaConnect.
mediaconnect/mediaconnectifacePackage mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code.
mediaconvert
mediaconvert/internal/endpoints
mediaconvert/mediaconvertifacePackage mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
mediaconvert/types
medialive
medialive/internal/endpoints
medialive/medialiveifacePackage medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
medialive/types
mediapackagePackage mediapackage provides the client and types for making API requests to MediaPackage.
mediapackage/mediapackageifacePackage mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
mediapackagevodPackage mediapackagevod provides the client and types for making API requests to MediaPackage Vod.
mediapackagevod/mediapackagevodifacePackage mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code.
mediastore
mediastoredata
mediastoredata/internal/endpoints
mediastoredata/mediastoredataifacePackage mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
mediastoredata/types
mediastore/internal/endpoints
mediastore/mediastoreifacePackage mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
mediastore/types
mediatailorPackage mediatailor provides the client and types for making API requests to MediaTailor.
mediatailor/mediatailorifacePackage mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code.
migrationhubPackage migrationhub provides the client and types for making API requests to AWS Migration Hub.
migrationhubconfigPackage migrationhubconfig provides the client and types for making API requests to AWS Migration Hub Config.
migrationhubconfig/migrationhubconfigifacePackage migrationhubconfigiface provides an interface to enable mocking the AWS Migration Hub Config service client for testing your code.
migrationhub/migrationhubifacePackage migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
mobilePackage mobile provides the client and types for making API requests to AWS Mobile.
mobileanalytics/mobileanalyticsifacePackage mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
mobile/mobileifacePackage mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
mqPackage mq provides the client and types for making API requests to AmazonMQ.
mq/mqifacePackage mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
mturk
mturk/internal/endpoints
mturk/mturkifacePackage mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
mturk/types
neptune
neptune/internal/endpoints
neptune/neptuneifacePackage neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code.
neptune/types
networkmanagerPackage networkmanager provides the client and types for making API requests to NetworkManager.
networkmanager/networkmanagerifacePackage networkmanageriface provides an interface to enable mocking the AWS Network Manager service client for testing your code.
opsworks
opsworkscmPackage opsworkscm provides the client and types for making API requests to OpsWorksCM.
opsworkscm/opsworkscmifacePackage opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code.
opsworks/internal/endpoints
opsworks/opsworksifacePackage opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
opsworks/types
organizationsPackage organizations provides the client and types for making API requests to Organizations.
organizations/organizationsifacePackage organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
outpostsPackage outposts provides the client and types for making API requests to Outposts.
outposts/outpostsifacePackage outpostsiface provides an interface to enable mocking the AWS Outposts service client for testing your code.
personalizePackage personalize provides the client and types for making API requests to Amazon Personalize.
personalizeeventsPackage personalizeevents provides the client and types for making API requests to Amazon Personalize Events.
personalizeevents/personalizeeventsifacePackage personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code.
personalize/personalizeifacePackage personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code.
personalizeruntimePackage personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime.
personalizeruntime/personalizeruntimeifacePackage personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code.
piPackage pi provides the client and types for making API requests to AWS PI.
pinpoint
pinpointemail
pinpointemail/internal/endpoints
pinpointemail/pinpointemailifacePackage pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code.
pinpointemail/types
pinpoint/internal/endpoints
pinpoint/pinpointifacePackage pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
pinpointsmsvoicePackage pinpointsmsvoice provides the client and types for making API requests to Pinpoint SMS Voice.
pinpointsmsvoice/pinpointsmsvoiceifacePackage pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code.
pinpoint/types
pi/piifacePackage piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code.
polly
polly/internal/endpoints
polly/pollyifacePackage pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
polly/types
pricingPackage pricing provides the client and types for making API requests to AWS Pricing.
pricing/pricingifacePackage pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
qldbPackage qldb provides the client and types for making API requests to QLDB.
qldb/qldbifacePackage qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code.
qldbsessionPackage qldbsession provides the client and types for making API requests to QLDB Session.
qldbsession/qldbsessionifacePackage qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code.
quicksight
quicksight/internal/endpoints
quicksight/quicksightifacePackage quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code.
quicksight/types
ramPackage ram provides the client and types for making API requests to RAM.
ram/ramifacePackage ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code.
rds
rdsdataPackage rdsdata provides the client and types for making API requests to AWS RDS DataService.
rdsdata/rdsdataifacePackage rdsdataiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code.
rds/internal/endpoints
rds/rdsifacePackage rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
rds/rdsutilsPackage rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database.
rds/types
redshift
redshift/internal/endpoints
redshift/redshiftifacePackage redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
redshift/types
rekognition
rekognition/internal/endpoints
rekognition/rekognitionifacePackage rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
rekognition/types
resourcegroupsPackage resourcegroups provides the client and types for making API requests to Resource Groups.
resourcegroups/resourcegroupsifacePackage resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
resourcegroupstaggingapiPackage resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
resourcegroupstaggingapi/resourcegroupstaggingapiifacePackage resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
robomaker
robomaker/internal/endpoints
robomaker/robomakerifacePackage robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code.
robomaker/types
route53
route53domainsPackage route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
route53domains/route53domainsifacePackage route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
route53/internal/endpoints
route53resolverPackage route53resolver provides the client and types for making API requests to Route53Resolver.
route53resolver/route53resolverifacePackage route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code.
route53/route53ifacePackage route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
route53/types
s3
s3control
s3control/internal/endpoints
s3control/s3controlifacePackage s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code.
s3control/types
s3/internal/arn
s3/internal/customizations
s3/internal/endpoints
s3/internal/external
s3/internal/s3testing
s3/types
sagemaker
sagemakera2iruntimePackage sagemakera2iruntime provides the client and types for making API requests to Amazon Augmented AI Runtime.
sagemakera2iruntime/sagemakera2iruntimeifacePackage sagemakera2iruntimeiface provides an interface to enable mocking the Amazon Augmented AI Runtime service client for testing your code.
sagemaker/internal/endpoints
sagemakerruntimePackage sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
sagemakerruntime/sagemakerruntimeifacePackage sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
sagemaker/sagemakerifacePackage sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
sagemaker/types
savingsplansPackage savingsplans provides the client and types for making API requests to AWSSavingsPlans.
savingsplans/savingsplansifacePackage savingsplansiface provides an interface to enable mocking the AWS Savings Plans service client for testing your code.
schemasPackage schemas provides the client and types for making API requests to Schemas.
schemas/schemasifacePackage schemasiface provides an interface to enable mocking the Schemas service client for testing your code.
secretsmanager
secretsmanager/internal/endpoints
secretsmanager/types
securityhub
securityhub/internal/endpoints
securityhub/securityhubifacePackage securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code.
securityhub/types
serverlessapplicationrepositoryPackage serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
serverlessapplicationrepository/serverlessapplicationrepositoryifacePackage serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
servicecatalog
servicecatalog/internal/endpoints
servicecatalog/servicecatalogifacePackage servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
servicecatalog/types
servicediscoveryPackage servicediscovery provides the client and types for making API requests to ServiceDiscovery.
servicediscovery/servicediscoveryifacePackage servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code.
servicequotasPackage servicequotas provides the client and types for making API requests to Service Quotas.
servicequotas/servicequotasifacePackage servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code.
ses
ses/internal/endpoints
ses/sesifacePackage sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
ses/types
sesv2Package sesv2 provides the client and types for making API requests to Amazon SES V2.
sesv2/sesv2ifacePackage sesv2iface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
sfn
sfn/internal/endpoints
sfn/sfnifacePackage sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
sfn/types
shieldPackage shield provides the client and types for making API requests to AWS Shield.
shield/shieldifacePackage shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
signerPackage signer provides the client and types for making API requests to signer.
signer/signerifacePackage signeriface provides an interface to enable mocking the AWS Signer service client for testing your code.
simpledbPackage simpledb provides the client and types for making API requests to Amazon SimpleDB.
simpledb/simpledbifacePackage simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
smsPackage sms provides the client and types for making API requests to SMS.
sms/smsifacePackage smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
snowballPackage snowball provides the client and types for making API requests to Amazon Snowball.
snowball/snowballifacePackage snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
sns
sns/internal/endpoints
sns/snsifacePackage snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
sns/types
sqs
sqs/internal/endpoints
sqs/types
ssm
ssm/internal/endpoints
ssm/types
ssoPackage sso provides the client and types for making API requests to SSO.
ssooidc
ssooidc/internal/endpoints
ssooidc/ssooidcifacePackage ssooidciface provides an interface to enable mocking the AWS SSO OIDC service client for testing your code.
ssooidc/types
sso/ssoifacePackage ssoiface provides an interface to enable mocking the AWS Single Sign-On service client for testing your code.
storagegateway
storagegateway/internal/endpoints
storagegateway/storagegatewayifacePackage storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
storagegateway/types
sts
sts/internal/endpoints
sts/stsifacePackage stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
sts/types
support
support/internal/endpoints
support/supportifacePackage supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
support/types
swf
swf/internal/endpoints
swf/swfifacePackage swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
swf/types
synthetics
synthetics/internal/endpoints
synthetics/syntheticsifacePackage syntheticsiface provides an interface to enable mocking the Synthetics service client for testing your code.
synthetics/types
textractPackage textract provides the client and types for making API requests to Amazon Textract.
textract/textractifacePackage textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code.
transcribePackage transcribe provides the client and types for making API requests to Amazon Transcribe Service.
transcribe/transcribeifacePackage transcribeiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
transferPackage transfer provides the client and types for making API requests to AWS Transfer.
transfer/transferifacePackage transferiface provides an interface to enable mocking the AWS Transfer Family service client for testing your code.
translatePackage translate provides the client and types for making API requests to Amazon Translate.
translate/translateifacePackage translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
waf
waf/internal/endpoints
wafregional
wafregional/internal/endpoints
wafregional/types
wafregional/wafregionalifacePackage wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
waf/types
wafv2
wafv2/internal/endpoints
wafv2/types
wafv2/wafv2ifacePackage wafv2iface provides an interface to enable mocking the AWS WAFV2 service client for testing your code.
waf/wafifacePackage wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
workdocs
workdocs/internal/endpoints
workdocs/types
workdocs/workdocsifacePackage workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
worklinkPackage worklink provides the client and types for making API requests to WorkLink.
worklink/worklinkifacePackage worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code.
workmailPackage workmail provides the client and types for making API requests to Amazon WorkMail.
workmailmessageflowPackage workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow.
workmailmessageflow/workmailmessageflowifacePackage workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code.
workmail/workmailifacePackage workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
workspaces
workspaces/internal/endpoints
workspaces/types
workspaces/workspacesifacePackage workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
xrayPackage xray provides the client and types for making API requests to AWS X-Ray.
xray/xrayifacePackage xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.

Updated 2020-10-01. Refresh now. Tools for package owners.